SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019306 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019306
Domain Number 1 Region: 275-403
Classification Level Classification E-value
Superfamily ApaG-like 7.19e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 94-260
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.06e-22
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-76
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000183
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019306   Gene: ENSCJAG00000010459   Transcript: ENSCJAT00000020392
Sequence length 410
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:96958997:96993293:-1 gene:ENSCJAG00000010459 transcript:ENSCJAT00000020392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINRRLSQLSSHDPLWRRHCKKYWLISE
DEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREE
DLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQ
QRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATF
TDWFTSYVNNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVHPPHYF
FTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRVYEYTS
CTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences F6RXC7
ENSCJAP00000019306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]