SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019395 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019395
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.27e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 3.4e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019395
Domain Number - Region: 418-451
Classification Level Classification E-value
Superfamily ARM repeat 0.00633
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019395   Gene: ENSCJAG00000010459   Transcript: ENSCJAT00000020487
Sequence length 471
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:96955926:96993272:-1 gene:ENSCJAG00000010459 transcript:ENSCJAT00000020487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEDEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEEDEDDDSADMDESDEEDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences F6Q260
ENSCJAP00000019395 XP_002755207.1.60252 ENSCJAP00000019395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]