SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019638 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019638
Domain Number 1 Region: 178-393
Classification Level Classification E-value
Superfamily Plakin repeat 1.03e-44
Family Plakin repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 398-580
Classification Level Classification E-value
Superfamily Plakin repeat 1.31e-39
Family Plakin repeat 0.00071
Further Details:      
 
Domain Number 3 Region: 4995-5113
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-29
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 5170-5329
Classification Level Classification E-value
Superfamily Spectrin repeat 9.82e-29
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 5390-5546
Classification Level Classification E-value
Superfamily Spectrin repeat 3.09e-28
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 4511-4670
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-24
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 4752-4892
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 8 Region: 3202-3361
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-23
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 9 Region: 4842-4989
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-22
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 5541-5657
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-21
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 3535-3689
Classification Level Classification E-value
Superfamily Spectrin repeat 7.1e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 4077-4213
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 13 Region: 5877-5956
Classification Level Classification E-value
Superfamily GAS2 domain-like 9.55e-20
Family GAS2 domain 0.00053
Further Details:      
 
Domain Number 14 Region: 3971-4125
Classification Level Classification E-value
Superfamily Spectrin repeat 6.31e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 15 Region: 4404-4551
Classification Level Classification E-value
Superfamily Spectrin repeat 7.38e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 16 Region: 2753-2880
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-18
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 17 Region: 3748-3908
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-17
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 18 Region: 5788-5868
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000101
Family Polcalcin 0.044
Further Details:      
 
Domain Number 19 Region: 4186-4337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 20 Region: 3423-3545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000456
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 21 Region: 2512-2621
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000008
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 22 Region: 4671-4781
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000838
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 23 Region: 2671-2784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000838
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 24 Region: 2951-3071
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000288
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 25 Region: 3110-3219
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000441
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 26 Region: 5667-5728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000705
Family Spectrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019638
Domain Number - Region: 2014-2092
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0011
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 2266-2379
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00111
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019638   Gene: ENSCJAG00000010349   Transcript: ENSCJAT00000020757
Sequence length 6171
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:57838507:58349712:-1 gene:ENSCJAG00000010349 transcript:ENSCJAT00000020757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDECQKYAEQYSATVKDYELQTMTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRY
TALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKKEHVEKAKELQKWVSNINKTLKDGEKAG
KPPFSKQKISSEEISTKKEQLSEALQTMQLFLAKHGDKMTDEERNELEKQVKNLQESYNL
LFSESLKQLQESQTTGDLKVEEKLDKVIAGTIDQTTGEVLSVFQAVLRGLIDYDTGLRLL
ETQLMISGLISPELRKCFDLKDAKSHGLIDEQILCQLKDLNKAKEIISVASPTTIPVLDA
LAQSMISESMAIKVLEILLSKGSLVIPATGEQLTLQNAFQQNLVSSALFSKVLDRQNMCK
DLIDPCTSEKVSLIDMVQRSILQENTGMWLLPVRPQEGGRITLKCGRNISILRAAHEGLI
DRETMFRLLSAQLLSGGLINSDSGQRMTVEEAVREGVIDRDTASSILTYQVQTGGIIQSN
PAKRLTVDEAVQCDLITSSSALLVLEAQRGYVGLIWPHSGEIFPTSSSLQQELITSELAY
KILNGRQKIAALYIPESSQVIGLDAAKQLGIIDNNTASILKNIILPDKMPDLGDLEACKN
ARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVATQSSEETKKIFLSYLMINSYMDANTGQR
LLLFDGDLDEAVGMLLEGCHAEFEGDTATKECLDVLSSSGVFLNNASGKEKDVCIATPSS
FNKCHCGEPEHEKTPENRKCATDEECHEMGNSDISSAFSQSETLANTMSVDPKVNSSSIV
RVSNPISYLTQTELVDISMLRSDSENRLTNCKNQGRVETNDRANECSHSKDIQNVPSDFI
ENPIVKSKRSKFCGMNETENEANTNRNPPIFDYSPRLSALLSHDKLRHSQGSFNDTHTPD
SNGNKCESPTLSFSDKTMLSDQIMGEKFQDQFLGIAAINISLPGEQSGQKSLNIISSNPQ
VQYHNDKYISNTSGEDEKTHPLFQQTPEDKEKESEIEEYSCAMTPGGNTDNASASVMCAT
PLLDETISASDYETSLLNDQQSDTGTDTESDDDFYDTPLFEDDDHDSLLLDGDDRDGLHP
EDYDTLQKENDEMTPPADVFYDVSKENENFMVPHGVLGGSLSVKGKAQCLQDFLRDAEKD
ELDSGEKMHFNTVGSDKVNGLSLGTVSERECANNLEGNESDSLTDYDIVGGEESFSASLK
YEDSGSWRGRREEYVTGQEFQSDTDHLDSVQSEESYGDYICDSNDQDDDDDDGIDEGEGG
IGHENGKPRCQDVAEDTDIQLCASIVSENSDENFSPSEISLVTERSNLPEYTTEIVGKSK
ENLLNHEMALKDVLLPIIEDTESEKTFGPASISHNNNISSTSELGNDLPNTKVELIQGSE
LPGLTDSVKGEDQYFKNMAPKVDSSLDHIICTEPDLIGKPSEESHLSLIGSVTDKDTQGN
GSDLIKGRDSKSDILMEDETSIQKMYVSEGEMLVEGLVEEENRDLKFLPGKNTRDSFKLI
NSQFPFPQITNNEELNQKGSLKKATVTLKDEPSSLQMIVSKSPVQSETLEEIFDTSVSKE
ISGGITSNIALWEGYTRIEKDLFTDGPEKELDLFTYLKHCAKNVKAKDGAKPNEDAPSHV
LITAPPMKEHLQLGVNNTKEKYTSTQEDSPPNEMIQSHDLCSEDGSSGGGTEISQFTPES
IEATLSILPLKHLEDVRKNDFLQLEPFTSGLGNDNSSNTLNTDYSLLEINNEKERIEQQL
PEEQAMSRRPQEKEVQIPELSQVFVEDVKDILDSRLKEGHMNPQEVEEPSACADTKILIQ
NLIKRDTTSQLVNEASTVPCYSQMSDSSGVFPVSNSSELKAESRDDPFCIENLKSELLLN
ILKQDQHSQKITGVLELMRELTHMEYDLEKRGITSKVLPLQLENIFYELLADRYSEKIEH
VGDLNQKACSTSEMKEEKSHILGDIKSKEGNHHSPNLQTVKEIGLEGSTVCASALPTDEK
LKASCNDFPNHLDCISGPKEMASGDSSTEQFSNELQQCLQHTEKMHEYLTLLQDMQPPLD
KQESLDNNLEALKNQLRQLEAFEFGLAPIAVILRKDMKLAEEFLKSLPGDFPRGHLEELS
ISHQSLQTAFSSLSNVSSEKTKQVMLAINSEMSKLAVSHEEFLHKLKSFSDWISEKGKSV
KDIEIVNVQDSEHVKKRLEFLKAKNVSKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQS
KQLLRLLNTTQKGFLDVQELVTTQLERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICD
LLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMEGSAQALAEVVKNTENFLKEN
GEKLSREDKALIEQKLNEAKMKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEE
SKTKIENLLDWLSNVDKDSEMAGTKHKQIIEQNGTHFREGDGKSAIGEEDEVNGNLLETD
IDGQVGTTQENLNQQYQKVKAQHEEIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQ
KNMKELKAHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGAD
DFSGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDKDNIDTSA
THREVQHKLDHATDRFRSLYSKCSVLGNNLKDLVDKYQHYEDASCGLLSGLQACEAMACK
HLSEPIAVDPKNLQRQLEETKALQGQISNQQVAVEKLKKTAEVLLDARGSLLPAKNDIQR
TLDDIVGRYEDLSKSVNDRNEKLQITLTRSLSVQDGLDEMLDWMGSVESSLQEQGQVPLN
SAALQDIISKNIMLEQDIAGRQSSVNAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSE
ASHKHKEKLAKMEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQES
TSEFLEHKKDLEVLHSLLKEISSHGLPGDKALVFEKTNNLSKKFKEMEDTIKEKKEAVTS
CQEQLDAFQVLVKSLKSWMKETTKRVPIVQPSFGAEDLGKSLEDTKKLQEEWSLKTPEIQ
KVNNSGISLCNLVSAVTTPAKAIAAVKSGGAILNGEGTATNTEEFWANKGLTSIKKDMTD
VSHGYEDLGLLLKDKIAELNAKLSKLQKAQEESSAMMQWLQKMNKTATKWHQTPAPTDTE
AVKTQVEQNKLFEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQEL
NQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQ
ILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLHGIVKEQLAAVTQKWDSLTGQLSDRCD
WIDQAIVKSTQYQSLLRSLSDKLNDLDNKLSSSLAVSTHPDAMNQQLESAQKMKQEIQQE
RKQIKVAQTLCEDLSALVKEEYLKAELSRQLESILKSFKDIEQKAENHVQHLQSACASSH
QFQQMSRDFQAWLDTKKEEENKSHPISAKVDVLESLIKDHKDFSKTLTAQSHIYEKTIAE
GENLLLKTQGSEKAALQSQLNMIKTNWDTFNKQVKERENRLKDSLEKALKYKEQVETLRP
WIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEVDK
EVVTDENKSLIQKVDMVTEQLHSKKLSLENMAQKFKEFQEVSKESKRQLQCAKEQLDVHD
SLGPQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDILLQVETIA
QEHSELSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQK
QKETIKAFLKKLEALIASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRA
QAREEQVEGTITRLEEFYSKLKEFSALLQKAEEHEESQGPVGMETETINQQLDVFKVFQK
EEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQE
ALLHCGRFQDAESLLSWMADTEELVAHQPPSAEFKVLRPRYRQKLLQRLLDDRKSTVEVI
KREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEP
LNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLS
SREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDK
LSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDK
LEAIKARYKDITKLSADVAKTLEQALQLARRLQSTHEELCTWLDKVEVELLSYETQVLKG
EAASQAQVRQKELKKEAKSHKAILDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLV
SDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQK
TFTMEILRHKDIIDELVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQL
ERAQSLVNQFWETYEELWPWLTETQTIISQLPAPALEYETLRQQQEEHRQLRELIAEHKP
HIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHD
KIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEM
IARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVV
TIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQEELDIVMNLGSELIAACGEP
DKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLAS
MSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLM
ELKLIWDSLDERIINRQHKLEGALLALGQFQHALDELLTWLTHTEGLLNEQKPVGGDPKA
IEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLE
KTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLSSKPLGGLPETAKEQLNVHMEV
CAAFEAKEETFKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEE
ALNLAMEFHNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQI
IELDKTGTHLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDEARKRAKQFHEA
WSKLMEWLEESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLK
EKTSLADDNLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYR
VEPQLAEDQPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWV
KVQMQELSTRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLP
DDEDALRTLIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARF
EEVLAWAKQHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKAL
IAEHQTFMEEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPS
GSQTQIETKNPRVNLLLREFANFDFDIWRKKYMRWMNHKKSRVMDFFRRIDKDQDGKITR
QEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPITDADKIE
DEVTRQVAKCKCAKRFQVEQIGDNKYRVSFQNNFGDSQQLRLVRILRSTVMVRVGGGWMA
LDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRTNMELREKFILADGASQGMA
AFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTTPKGTPIQGSKLRLPGYLSG
KGFHSGEDSGLITTAAARVRTQFADSRKTPSRPGSRAGSKAGSRASSRRGSDASDFDISE
IQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSPASKLDKSSKR
Download sequence
Identical sequences F6TP63
ENSCJAP00000019089 ENSCJAP00000019638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]