SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019645 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019645
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-74
Family Calponin-homology domain, CH-domain 0.00000439
Further Details:      
 
Domain Number 2 Region: 218-334
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-28
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 4242-4352
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 3970-4131
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-26
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 3750-3909
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 4081-4230
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-22
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 7 Region: 2774-2928
Classification Level Classification E-value
Superfamily Spectrin repeat 5.14e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 2441-2588
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-21
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 3316-3452
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-20
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 3210-3364
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-19
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 1992-2132
Classification Level Classification E-value
Superfamily Spectrin repeat 9.42e-19
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 3644-3790
Classification Level Classification E-value
Superfamily Spectrin repeat 4.07e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 13 Region: 2987-3147
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-17
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 14 Region: 652-754
Classification Level Classification E-value
Superfamily Spectrin repeat 4.03e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 15 Region: 1187-1315,1342-1370
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 16 Region: 3425-3576
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000158
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 17 Region: 2662-2784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000064
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 18 Region: 1738-1860
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000411
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 19 Region: 1910-2023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000615
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 20 Region: 2190-2310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000202
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 21 Region: 2574-2675
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000072
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 22 Region: 727-834,955-975
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000124
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 23 Region: 2350-2458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000264
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 24 Region: 559-649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000641
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 25 Region: 4352-4396
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000104
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000019645
Domain Number - Region: 1506-1618
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000245
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number - Region: 981-1122
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0076
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019645   Gene: ENSCJAG00000010349   Transcript: ENSCJAT00000020764
Sequence length 4397
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:57838507:58229362:-1 gene:ENSCJAG00000010349 transcript:ENSCJAT00000020764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVRKHVNDLYEDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVK
LVNIRNDDITDGNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYA
GIRCENFTTCWRDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLD
PEDVDVSSPDEKSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRH
HVTTMSERTFPNNPIELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKL
LQGYHPNDIEKEWGKLIIAMLEREKALRPEVERLEMLQQIASRVQRDSVICEDKLILARN
ALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQVDQLVQRVAKL
RDEIMALRNECSSVYSKGRMLTTEQTKLMISGITQSLNSGFAQTLHPSLSSGLTQSLTPS
LTSSSITSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLL
KSSLLDQNLTEEEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIE
EFESSLKEAKISEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLVTLHNFVSRAT
NELIWLNEKEEEEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLEN
HPARLTIEAYRAAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQ
RKYSCDRSSSIHKLEDLVQESMVLIQNLLQYKSTVASLMGKAKTVIQLKPRNSDCPLKTS
IPIKAICDYRQIEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAV
DFANRIEQQYQNVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVL
SNLQSRFEDFLEDSQESQIFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYI
SEVRNIRLRLENCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNK
CEEFFSQAAASSSVPMLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVK
LYETKLCEEEAVIADKNNIQNLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKT
YKERDLDFDWHKEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQV
ETNQRKIQENQPENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQT
MTYRAMVDSQQKSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLE
EEEKSLEEEKKEHVEKAKELQKWVSNINKTLKDGEKAGKPPFSKQKISSEEISTKKEQLS
EALQTMQLFLAKHGDKMTDEERNELEKQVKNLQESYNLLFSESLKQLQESQTTGDLKVEE
KIVAERQQEYKEKLQGICDLLTQTENRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMEG
SAQALAEVVKNTENFLKENGEKLSREDKALIEQKLNEAKMKCEQLNLKAEQSKKELDKVV
TTAIKEETEKVAAVKQLEESKTKIENLLDWLSNVDKDSEMAGTKHKQIIEQNGTHFREGD
GKSAIGEEDEVNGNLLETDIDGQVGTTQENLNQQYQKVKAQHEEIISQHQAVIIATQSAQ
VLLEKQGQYLSPEEKEKLQKNMKELKAHYETALAESEKKMKLTHSLQEELEKFDADYTEF
EHWLQQSEQELENLEAGADDFSGLMTKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAK
SCSKRDGGKVDKDNIDTSATHREVQHKLDHATDRFRSLYSKCSVLGNNLKDLVDKYQHYE
DASCGLLSGLQACEAMACKHLSEPIAVDPKNLQRQLEETKALQGQISNQQVAVEKLKKTA
EVLLDARGSLLPAKNDIQRTLDDIVGRYEDLSKSVNDRNEKLQITLTRSLSVQDGLDEML
DWMGSVESSLQEQGQVPLNSAALQDIISKNIMLEQDIAGRQSSVNAMNEKVKKFMETTDP
STASSLQAKMKDLSARFSEASHKHKEKLAKMEELKTKVELFENLSEKLQTFLETKTQALT
EVDVPGKDVTELSQYMQESTSEFLEHKKDLEVLHSLLKEISSHGLPGDKALVFEKTNNLS
KKFKEMEDTIKEKKEAVTSCQEQLDAFQVLVKSLKSWMKETTKRVPIVQPSFGAEDLGKS
LEDTKKLQEEWSLKTPEIQKVNNSGISLCNLVSAVTTPAKAIAAVKSGGAILNGEGTATN
TEEFWANKGLTSIKKDMTDVSHGYEDLGLLLKDKIAELNAKLSKLQKAQEESSAMMQWLQ
KMNKTATKWHQTPAPTDTEAVKTQVEQNKLFEAELKQNVNKVQELKDKLTELLEENPDTP
EAPRWKQMLTEIDSKWQELNQLTIDRQQKLEESSNNLTQFQTVEAQLKQWLVEKELMVSV
LGPLSIDPNMLNTQRQQVQILLQEFATRKPQYEQLTAAGQGILSRPGEDPSLHGIVKEQL
AAVTQKWDSLTGQLSDRCDWIDQAIVKSTQYQSLLRSLSDKLNDLDNKLSSSLAVSTHPD
AMNQQLESAQKMKQEIQQERKQIKVAQTLCEDLSALVKEEYLKAELSRQLESILKSFKDI
EQKAENHVQHLQSACASSHQFQQMSRDFQAWLDTKKEEENKSHPISAKVDVLESLIKDHK
DFSKTLTAQSHIYEKTIAEGENLLLKTQGSEKAALQSQLNMIKTNWDTFNKQVKERENRL
KDSLEKALKYKEQVETLRPWIDKCQNNLEEIKFCLDPAEGENSIAKLKSLQKEMDQHFGM
VELLNNTANSLLSVCEVDKEVVTDENKSLIQKVDMVTEQLHSKKLSLENMAQKFKEFQEV
SKESKRQLQCAKEQLDVHDSLGPQAYSNKYLTMLQTQQKSLQALKHQVDLAKRLAQDLVV
EASDSKGTSDILLQVETIAQEHSELSQQVDEKCSFLETKLQGIGHFQNTIREMFSQFAEF
DDELDSMAPVGRDAETLQKQKETIKAFLKKLEALIASNDNANKTCKMMLATEETSPDLVG
IKRDLEALSKQCNKLLDRAQAREEQVEGTITRLEEFYSKLKEFSALLQKAEEHEESQGPV
GMETETINQQLDVFKVFQKEEIEPLQGKQQDVNWLGQGLIQSAAKSTSTQGLEHDLDDVN
ARWKTLNKKVAQRAAQLQEALLHCGRFQDAESLLSWMADTEELVAHQPPSAEFKVLRPRY
RQKLLQRLLDDRKSTVEVIKREGEKIATTAEPADKVKILKQLSLLDSRWEALLNKAETRN
RQLEGISVVAQQFHETLEPLNEWLTTIEKRLVNCEPIGTQASKLEEQIAQHKALEDDIIN
HNKHLHQAVSIGQSLKVLSSREDKDMVQSKLDFSQVWYIEIQEKSHSRSELLQQALCNAK
IFGEDEVELMNWLNEVHDKLSKLSVQDYSTEGLWKQQSELRVLQEDILLRKQNVDQALLN
GLELLKQTTGDEVLIIQDKLEAIKARYKDITKLSADVAKTLEQALQLARRLQSTHEELCT
WLDKVEVELLSYETQVLKGEAASQAQVRQKELKKEAKSHKAILDSLNEVSSALLELVPWR
AREGLEKMVAEDNERYRLVSDTITQKVEEIDAAILRSQQFDQAADAELSWITETEKKLMS
LGDIRLEQDQTSAQLQVQKTFTMEILRHKDIIDELVKSGHKIMTACSEEEKQSMKKKLDK
VLKNYDTICQINSERYLQLERAQSLVNQFWETYEELWPWLTETQTIISQLPAPALEYETL
RQQQEEHRQLRELIAEHKPHIDKMNKTGPQLLELSPGEGFSIQEKYVAADTLYSQIKEDV
KKRAVALDEAISQSTQFHDKIDQILESLERIVERLRQPPSISAEVEKIKEQISENKNVSV
DMEKLQPLYETLKQRGEEMIARSGGTDKDISAKAVQDKLDQMVFIWENIHTLVEEREAKL
LDVMELAEKFWCDHMSLVVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEAIREEIDGLQE
ELDIVMNLGSELIAACGEPDKPIVKKSIDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQ
DGLQAVFDWVDIAGGKLASMSPIGTDLETVKQQIEELKQFKSEAYQQQIEMERLNHQAEL
LLKKVTEESDKHTVQDPLMELKLIWDSLDERIINRQHKLEGALLALGQFQHALDELLTWL
THTEGLLNEQKPVGGDPKAIEIELAKHHVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEA
SNLQNKLEVLNQRWQNVLEKTEQRKQQLDGALRQAKGFHGEIEDLQQWLTDTERHLLSSK
PLGGLPETAKEQLNVHM
Download sequence
Identical sequences F6TN02
ENSCJAP00000019645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]