SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019719 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019719
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000314
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 2 Region: 52-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019719   Gene: ENSCJAG00000010700   Transcript: ENSCJAT00000020841
Sequence length 282
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:7974576:7980729:-1 gene:ENSCJAG00000010700 transcript:ENSCJAT00000020841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSGWMARGGVERTGALGLALRLLLGLGLSLEAAATPLPTQTSGQAAGDRAGSCPPTKFQC
RTGDLCVPLNWRCDTDEDCPDASDEEECPIEPCTQNGQCPPPPGHLCSCTGVSDCSGETD
EKLRNCSRPTCPAGELHCTLSDECIPLTWLCDGHPDCSDSSDELGCGTSETLLKGNATTM
GPPVTFESVTSLRNATSSGRPIAAAELPSPCGQSLVGLGALAFPSYYSSVHLFPTAVLST
SLVAATLLLLFWLRAQGRLCPMGLLVNAKESLVVSERKTFLI
Download sequence
Identical sequences F6XKF7
ENSCJAP00000019712 ENSCJAP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]