SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020199 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020199
Domain Number 1 Region: 1243-1421
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 2 Region: 260-396
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 3 Region: 1057-1194
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-21
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 4 Region: 807-960
Classification Level Classification E-value
Superfamily Spectrin repeat 4.74e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 481-622
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 6 Region: 1428-1492
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000059
Family Pleckstrin-homology domain (PH domain) 0.0000395
Further Details:      
 
Domain Number 7 Region: 16-170
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000706
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 8 Region: 627-734
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000042
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 9 Region: 174-290
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000209
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000020199
Domain Number - Region: 401-513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0349
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020199   Gene: ENSCJAG00000010904   Transcript: ENSCJAT00000021340
Sequence length 1507
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:189122080:189355824:-1 gene:ENSCJAG00000010904 transcript:ENSCJAT00000021340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLIS
YLACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQR
TNFGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATH
MLSRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSS
ESFPKKNSGSGNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDA
EKMFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLV
ESGHYASQQIRQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACG
EVDLPSELQDLEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASAN
YSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAF
LSKHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAA
HQLEDRIQDFVRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDL
IKRFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQS
QMEELFQERKIKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQ
HHADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQ
QELDLAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQRE
HEQFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKL
VNASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEA
FLKACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTM
RKRRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITA
KQTKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGIS
SDSNKSSKSLQLDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVR
DLRECMDTYLWEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDV
GHCFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRI
TKYQLLLKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQ
ESFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFVSIVQNCKSKG
NIVAVFL
Download sequence
Identical sequences F7FYR8
ENSCJAP00000020199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]