SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020787 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020787
Domain Number 1 Region: 723-980
Classification Level Classification E-value
Superfamily RNI-like 1.57e-48
Family 28-residue LRR 0.0000743
Further Details:      
 
Domain Number 2 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 8.12e-22
Family Pyrin domain, PYD 0.00000869
Further Details:      
 
Domain Number 3 Region: 1383-1469
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-16
Family Caspase recruitment domain, CARD 0.022
Further Details:      
 
Domain Number 4 Region: 330-422,457-505
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000155
Family ABC transporter ATPase domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020787   Gene: ENSCJAG00000011265   Transcript: ENSCJAT00000021973
Sequence length 1480
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:97662609:97738535:-1 gene:ENSCJAG00000011265 transcript:ENSCJAT00000021973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAWGRLACYLELLEKEELKKFQFLLTNKVHSRGSSGETPAQPEKTSGMQVASHLVAQ
YGEQQAWDLAIHIWEQMGLRSLCAQAQEEAGHSLSFRYSLSEPSMGSPNQPTSTAVLRSQ
IPELQGCTQRSERSVSRRLPDTSGHQWREIISSLLYQAPLSSLDYGSPSYESPSAPISTA
ELGSWKSPLEPSPVPREQEAPGTQWPLDEMLGHYYTEITRRAFQSSTRKGKKIWATDKGT
KARTYQCLQPVHCVAWRIRERDQSLWRESPCSTWSWKNEDLNEKFTQLLLLQRPHPRSHK
CLVRGRLLHNVEENQGHLIELGDLFGPGLDTQEPHIVILQGAAGIGKSTLARRVREAWGR
GQLYRDCFQHVFYFSCRELAQSKVLSLAELIEKDWTATQAPIRQILSRPERLLFILDGVD
EPKWVLEEQSSELCLHWSQPQPADALLGSLLGKTILPKASFLITARTTALQHLIPSLEQA
RWVEVLGFSESSRKEYFYKYFTDEMQASRAFRLVKSNKELWALCLVPWVSWLACTCLMQQ
MKQKEELTLTSKTTTTLCLHYFSQALQAQPLGSQLQGFCSLAAEGTWQRKTLFSPDDLKK
HGLDGAIISSLLKMDILQEHPIPLSYSFIHLCFQEFFAAMSCALEDKKGRGEHSNHIMGL
GKLLEAYGTHDLLRAPTTRFLLGLLSEQGAREMENIFDCRLSRERKKRLLQCAQFLQPPL
QSHSLEFLHCLYETQDKSFLTQMMAHFQEVCMCVETDMELLVCTFCIKFCHNVKKLQLIE
GRQHGPARSLDRVVLFRWVPATDAYWQILFSVLKVTRSLKELDLSGNLLSLSAVQSLCET
LKYPRCLLETLRLAGCGLTAEGCKDLASGLRTNQTLTEVELSFNVLTDAGAKHLCQGLRW
PTCKLQRLQLVSCGLTSGCCRALASVLSASPSLTDLDLQQNDLDDVGVQLLCKGLRRPTC
KLTRLGLDQTTLSNETRQELRALEQEKSQLLLFYTRKPSAMIPNEGLHTGDMSNSTSSLK
LQRLRSVHLLKHVPLSTCPTGHTGKSAPSVPVCKESVPRIAQQELAYLPSPASQEDLHTK
PLGNDDDFWGPTGPVATEVVDKERSLYRVHFPVAGTYRWPNMGLCFVVREAVTTEIEFCV
WDKLLGEINQQQSWMVAGPLLDIKAEPEAIKAVHLPHFVSLQGGHIDTSLFQVAHFKEEG
MLLEKPAKVELHHIVLEDPSFSPMGVLLRMIHNALRIFPVTSMVLLYHRIHPEEVTFHLY
LIPSDCSIRKAIDDEETKFQFVRLHKPPPLTPLYMGSRYAVSGSEELEIIPEELELCYRS
PGEPQLFSEFYVGHLGSGIRLQMKNKTDETLVWEALVKPGDLTPATTLVPPAPKALPSPL
DAPGLLHFVDQYREQLVARVTSVEPVLDNLLGHVLSQEQYERVLAEDTRPSKMRKLFSFS
QSWDRSCKDRLYQALKDTHPYLIMELWEKGSKKGLLPLSI
Download sequence
Identical sequences F7GJ44
ENSCJAP00000020787 ENSCJAP00000020774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]