SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000020962 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000020962
Domain Number 1 Region: 146-367,411-460
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.83e-50
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 
Domain Number 2 Region: 576-670
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00000000000209
Family Glycerol-3-phosphate transporter 0.045
Further Details:      
 
Domain Number 3 Region: 484-565
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000196
Family Pentapeptide repeats 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000020962   Gene: ENSCJAG00000020031   Transcript: ENSCJAT00000022164
Sequence length 677
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:131986687:132272719:-1 gene:ENSCJAG00000020031 transcript:ENSCJAT00000022164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYP
AGETYDGEANDDEGSSEATEGHDEYDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDR
RELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE
TDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQG
YGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI
IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMIL
KLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT
FMRCFNYPVRDNTTKLTIVWFTLSFGYYGLSVWFPDVIKHLQSDEYALLTRNVQKDKYAN
FSINFTMENQIHTGMEYDNGRFVGVKFKSVTFKDSVFKSCTFEDVTSLNTYFRNCTFIDT
VFDNTDFEPYKFIDSEFKNCSFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVS
ALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVE
LYPTDRRHRVLPCCPSW
Download sequence
Identical sequences F7GVH6
ENSCJAP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]