SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000021181 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000021181
Domain Number 1 Region: 82-140
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000021181   Gene: ENSCJAG00000011529   Transcript: ENSCJAT00000022396
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:36858661:36859731:1 gene:ENSCJAG00000011529 transcript:ENSCJAT00000022396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEEDSLRNGDDDQ
KPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSK
IETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQ
NQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFES
PLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFS
GTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Download sequence
Identical sequences F6SAJ7
ENSGGOP00000017698 ENSCJAP00000021181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]