SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022797 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022797
Domain Number 1 Region: 945-1072
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-21
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022797   Gene: ENSCJAG00000012416   Transcript: ENSCJAT00000024119
Sequence length 1089
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:4351341:4412002:1 gene:ENSCJAG00000012416 transcript:ENSCJAT00000024119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQRKMAERPIAAPRSMTHTKRAREPLSEASNQQPVAGGKEKS
CTKPSPSKKRCSDDTEAEASNLENKQPVESTAKSCSPSPVSPQVQPQAADTVSDSVAVPA
SLLGMRKGLNSRPEATAASSVKTRMQKLAEQRRRWDSDEMTDDVPESSLFSPTPSSSEKA
ASPPKPPLSNASATPVGRRGRLANLAATICSWEDDVNHSSAKQNRALEQPGTTCLSKFSS
ASGASARINSSSVKQEATCCSQRDGDACLNKAPSSSAADASLVNASISSSAKATSPVKST
TSTITDAESYKGQNPELLQKTASPLKTGASKPIVKSALSQTVPSKGELNREICLQSHSKD
KSTTPGGAGIKPFLERFGERCQEHSKESPARSTPQRTPIITPNTKAIQERLLKQNASSST
THLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKRPEPKQESHCQSTPLKNCQSV
SKTQSLPATEKVTENQTPAKNSSTQPIEVIREIEMSVDNDDDINSSKVINDLFSDVLEEG
ELEVEKSQEEMDEALAESREEQEDALNISSMSLLAPLAQTVGAVSPESLMSTPRLELKDT
SRSDESPKPGKFQRTRVPRAESGDSLGSEDRDLLYSIDAYRSQRFKETERPSVKQVIVRK
EDTTKAAEGNHAFPCQVNIKQKMQELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEA
EAERLLLIATEKRTLLIDELNKLKNEGPQRKNKASPVSQSEFIPSKGSVTLSEIRLPLKA
DFVCSTVQKPDAANYYYLIILKAGAENMVATPLASTSNSLNGDALAFTTTFALQDVSNDF
EINIEVYSLVQKKDPARLDKKKKTSKSKAITPKRLLTSITTKSNIHSSVMASPGGLNAVR
TSNFTLVGSYTLSLASVGNTKFALDKVPLLSILLSPFYLLWKCQVNSSVEERGFLTIFED
VSGFGAWHRRWCVLSGNCVSYWTYPDDEKRKNPIGRINLANCTSHQIEPANREFCARRNT
FELITVRPQREDDRETLVSQCRDTLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPD
ACYKPIGKP
Download sequence
Identical sequences F7I3M5
ENSCJAP00000022797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]