SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022803 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022803
Domain Number 1 Region: 982-1109
Classification Level Classification E-value
Superfamily PH domain-like 8.13e-21
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022803   Gene: ENSCJAG00000012416   Transcript: ENSCJAT00000024125
Sequence length 1126
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:4351341:4412002:1 gene:ENSCJAG00000012416 transcript:ENSCJAT00000024125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFTEKLLERTRARRENLQRKMAERPIAAPRSMTHTKRAREPLSEASNQQPVAGGKEKS
CTKPSPSKKRCSDDTEAEASNLENKQPVESTAKSCSPSPVSPQVQPQAADTVSDSVAVPA
SLLGMRKGLNSRPEATAASSVKTRMQKLAEQRRRWDSDEMTDDVPESSLFSPTPSSSEKA
ASPPKPPLSNASATPVGRRGRLANLAATICSWEDDVNHSSAKQNRALEQPGTTCLSKFSS
ASGASARINSSSVKQEATCCSQRDGDACLNKAPSSSAADASLVNASISSSAKATSPVKST
TSTITDAESYKGQNPELLQKTASPLKTGASKPIVKSALSQTVPSKGELNREICLQSHSKD
KSTTPGGAGIKPFLERFGERCQEHSKESPARSTPQRTPIITPNTKAIQERLLKQNASSST
THLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKRPEPKQESHCQSTPLKNCQSV
SKTQSLPATEKVTENQTPAKNSSTQPIGSTEFEMTKSSPLKITLFLEEDRSLKVTSDPKV
EQQIEVIREIEMSVDNDDDINSSKVINDLFSDVLEEGELEVEKSQEEMDEALAESREEQE
DALNISSMSLLAPLAQTVGAVSPESLMSTPRLELKDTSRSDESPKPGKFQRTRVPRAESG
DSLGSEDRDLLYSIDAYRSQRFKETERPSVKQVIVRKEDTTKAAEGNHAFPCQVNIKQKM
QELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATEKRTLLIDELNKL
KNEGPQRKNKASPVSQSEFIPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKA
GAENMVATPLASTSNSLNGDALAFTTTFALQDVSNDFEINIEVYSLVQKKDPARLDKKKK
TSKSKAITPKRLLTSITTKSNIHSSVMASPGGLNAVRTSNFTLVGSYTLSLASVGNTKFA
LDKVPLLSILLSPFYLLWKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCVSYWT
YPDDEKRKNPIGRINLANCTSHQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRD
TLCVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP
Download sequence
Identical sequences F7HYX4
ENSCJAP00000022797 ENSCJAP00000022803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]