SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000022923 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000022923
Domain Number 1 Region: 56-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000118
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000022923   Gene: ENSCJAG00000012515   Transcript: ENSCJAT00000024253
Sequence length 333
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:110932879:110952065:-1 gene:ENSCJAG00000012515 transcript:ENSCJAT00000024253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPLEADKIVFLLSRVKRNITLQLIMATPEESSNPHESMTPQLPAQPQDLDSRVARRRLS
QARHRATLAALFDNLRKTVYSQSDLTASKWQVLNKAKSYIPELEQTLDNLLKLKVSLNLE
DGHASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIVSLQEGALPIV
SAAISHLWQNLSEERKASLRQAWAQKHRDPASLAGACREAACAEGSMKDSGVDSQGASCS
LVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASSNPENPEEKFQLYMQIINFFKGL
GCANTRVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences F7IFD5
ENSCJAP00000022923 ENSCJAP00000051264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]