SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023287 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023287
Domain Number 1 Region: 45-146
Classification Level Classification E-value
Superfamily POZ domain 3.73e-31
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023287   Gene: ENSCJAG00000012707   Transcript: ENSCJAT00000024639
Sequence length 232
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:199372695:199385983:1 gene:ENSCJAG00000012707 transcript:ENSCJAT00000024639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPARRTDLLGRAKQGGVGSGSSAGAGPSPRPTLSQGARTTGGWGKWVRLNVGGTVFLTTR
QTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEE
GVLEEAEFYNIGPLIRIIKDRMEEKDYTVTQELPVFRVLSPPPLKLVTLGQVHGPSLGPR
WLVNIGSSYSYGSEDQAEFLCVVSKELHSSPNGLSSESGRKTKVSPPASARV
Download sequence
Identical sequences F7II89
ENSCJAP00000023287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]