SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024027 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024027
Domain Number 1 Region: 98-243
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-31
Family AlaX-like 0.024
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000494
Family AlaX-M N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024027   Gene: ENSCJAG00000013086   Transcript: ENSCJAT00000025417
Sequence length 413
Comment pep:novel chromosome:C_jacchus3.2.1:5:75413691:75426833:-1 gene:ENSCJAG00000013086 transcript:ENSCJAT00000025417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRCQRDSYARKFTTTVVSCRPAELQTEGSNGKKEVLSGFQVVLEDTLLFPEGGGQPDD
HGTINDIPVLKVTRRGEQADHFTQTPLEPGSQVLVQVDWERRFDHMQQHSGQHLITAVAD
HLFKLKTTSWELGRFRSVIELDSPSVTAEQVAAIEQSVNEKIRDRLPVNVQELSLDDPEV
EQVRGRGLPDDHAGPIRVVTIKGVDSNMCCGTHVSNLSDLQVIKMLGTEKGKKNKTNLIF
LAGNRVLKWMGRSHGTEKALTALLKCGAEDHVEAVKKLQNSTKLLQKNNLSLLRDLAVHS
AHRLRNSPDWGGVVLLHRSPGFGLILTSLIANEIGSEETLLFLTVGDEKGAGLFLLAGPP
VAVETLGPRVAEVLEGKGAGKKGRFQGKAMKMSRRPEAQALLQDYISTQSTKE
Download sequence
Identical sequences F7GYX8
ENSCJAP00000024027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]