SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024047 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024047
Domain Number 1 Region: 54-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000001
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024047   Gene: ENSCJAG00000013096   Transcript: ENSCJAT00000025438
Sequence length 217
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:145458019:145713443:-1 gene:ENSCJAG00000013096 transcript:ENSCJAT00000025438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQPATERLQHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKV
TYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREGVFPTNALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAH
AMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Download sequence
Identical sequences F7GTM1
ENSCJAP00000024047 XP_002749912.1.60252 ENSCJAP00000024047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]