SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024891 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024891
Domain Number 1 Region: 504-602
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-26
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000024891
Domain Number - Region: 170-304
Classification Level Classification E-value
Superfamily Typo IV secretion system protein TraC 0.00144
Family Typo IV secretion system protein TraC 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024891   Gene: ENSCJAG00000013463   Transcript: ENSCJAT00000026317
Sequence length 613
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:16249964:16276593:1 gene:ENSCJAG00000013463 transcript:ENSCJAT00000026317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERALLQGEREAERSLLQKEQKAVDQLQEELVALETGIQKERDKERAELAAGRRHLEARQ
ALYAELQTQLDNCPESVREQLQEQLRREAEALETETKLFEDLEFQQLERESRVEEERELA
GQGLLRSKAELLRSIAKRKERLAVLDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEK
LTVLERRYHSLTGGRPFPKTTSTLKEVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQ
LSVATLGRSPSPKSALLTQNGTGSLPRNLAATLQDIETKRQLALQQKGQQVIEEQRRRLA
ELKQKAAAEAQCQWDALHGAAPFPAGPSGFPPLMHHSILHHLPAGRERGEESEHAYDTLS
LESSDSMETSISTGGNSACSPDNMSSASGLDMGKIEEMEKMLKEAHAEKSRLMESREREM
ELRRQALEEERRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDF
DLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDK
HETKLKGVIYFQAIEEVYYDHLRSAAKSPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDV
IVTGAEGYTQFMN
Download sequence
Identical sequences F6SYF9
ENSCJAP00000024891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]