SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025480 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025480
Domain Number 1 Region: 1742-1782,1819-2011
Classification Level Classification E-value
Superfamily Plakin repeat 1.92e-59
Family Plakin repeat 0.0000112
Further Details:      
 
Domain Number 2 Region: 1643-1770
Classification Level Classification E-value
Superfamily Plakin repeat 0.00000000000000209
Family Plakin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 202-332
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000023
Family Spectrin repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025480
Domain Number - Region: 712-826,854-881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000222
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number - Region: 587-717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00106
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 157-201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.023
Family Spectrin repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025480   Gene: ENSCJAG00000013819   Transcript: ENSCJAT00000026929
Sequence length 2032
Comment pep:novel chromosome:C_jacchus3.2.1:5:125267907:125291068:-1 gene:ENSCJAG00000013819 transcript:ENSCJAT00000026929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKGLSKGSQGKGSPKGSPAKGSPKGSPSKHSRAATQELALLISRMQANADQVERDILET
QKRLQQDRLNSEQSQALQHQQETGRSLKEAEVLLKDLFLDLDIVRRLFHPLFEDIEKEFI
IKQLHERVTQECAEYRALYEKMVLPPDVGPRVDWARVLEQKQKQVFAGQYGPGIAELEQQ
IAEHNILQKEIDAYGQQLRSLIGPDAATVRTQYRDLLKAASWRGQSLGSLYTHLQGCTRQ
LSALGEQQRRILQQDWSDLMADPAGVRREYEHFKQYELLSQEQSVNQLEDDGERMVELRH
PAVGPIQAHQEALKMEWQNFLNLCICQESQLQHVEDYRRFQEEADSVSQTLAKLNSNLDA
KYSPAPGGPPSTPSELLQQLEAEEKQLAITERATEDLQRRSREVAPLPQRRQPPQQPLHV
DSICDWDSGEVQLLRGERYKLMDNTDPHTWVVQGPGGETKRAPAACLCIPAPDPEAVARA
SRLASELQALKQKLATIQSRLKASAAESVRPNQQAPSGSAPANPQAQKLLTQMTRLDRDL
GQIERQVLAWARAPLSRTTPLEDLEGRIHSHEGIAQRLQSLGVEKETAQKECEAFLSTRP
VGPAALQLPVALNSVKNRFSDVQVLCSLYGEKAKAALGLERQIRDAGRIIQGLEATLVQE
APIPAEPGALQERVSELQRQRRELLDQQACVLGLHRALNAAEHACAALQNNFQEFCQDLP
RQQRQVQALTDRYHAAGDQLDLREKMMQDAALTYQQFKNCKDNLSSWLEHLPHGQVRPSD
GPSQIAYKLQAQKRLTQEIQSREHDRAMASRHSQALQAVLQDYELQADTYRCSLEPTLAV
RAPKRPRVAPLQESIQAQEKNLAKAYTEVAVAQQQQLQQLEFARKMLEKKELSEDIQGTH
DAKQGSQSPAQAGRESEALKAQLEEERKRVAQVQHELEEQRSQLLQLRTQRPVERLEEKE
VVEFYRDPQLEGSLSRAKVQVEEEGKRRAGLQADLEAAAQKVVQLESKRKTMQPHLLTKE
VTQVERDPGLDSQAAQLRVQIQQLRGEDAVVSAQLEGLKKELLALEKREVDVKEKVVVKE
VVKVEKDLEMLKAAQTLRLQLEEDTARRKGVEEAVAKLRARIQDLERAISAVKPKVIVKE
VKKVEQDPGLLQESSRLRSLLEEERSKNTTLARELSDLHSKYSVVEKQRPKVQLQEHVRE
VFQVDPETEQEIARLRAKLQETAGKRSSVEREVEKLLPDLEVLRAQKPMVEYKEVTQEVV
RHERSPEVLREIDRLKAQLNELVNSHGRSQEQLIRLQGERDEWRRERAKVETKTVSKEVV
RHEKDPVLEKEAERLRHEVREAAQKRRVAEDLLYELQSKRLLLERRKPEEKVVVQEVVVT
QKDPKLREEHSRLSQSLDEEVGRRRQLELEVQQLRAGVEEQEGLLSFQEDRSKKLAVEKE
LRQLTLRIQELEKRPPAVQEKIIMEEVVKLEKDPDLEKSTDALRRDLDQEKAQVKELHRE
CKNLQVQIDVLQKAKSQEKTIYKEVIRVQKDRVLEDERARVWEMLNRERTARQAREEEAR
RLQERINRAEALERTWSREEAELQRARDQADQERGRLQQELRTLERQKQQQTLQLQEESK
LLNQKTESKRQKAAQRGQELSRLEAAILHEKDQIYDKERTLRDLHAKVSREELSQETQTR
ETNLSTKISILEPETGKDMSPYEAYKSGIIDRGQYLQLQELECDWEEVTTSGPCGEESVL
LDRKSGKQYSIEAALRCRRISKEEYHLYKDGHLPISEFALLVAGETKPSSSLSIGSIISK
SPLASPAPQSASFFSPSFSLGLGDDSFPIAGIYDTTTDNKCSIKTAMAKNMLDPITGQKL
LEAQAATGGIVDLLSRERYSVHKAMERGLIENTSQRLLNAQKAFTGIEDPVTKRLSVGEA
QKGWMPRESVLPHLQVQHLTGGLIDPKRTGRIPIQQALLSGMISEELAQLLQDESNYEKD
LTDPISKERLSYKEAIGRCRKDPLSGLLLLPAALEGYRCYRLASPTVPCSLR
Download sequence
Identical sequences F7BYM6
ENSCJAP00000025480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]