SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026150 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026150
Domain Number 1 Region: 114-162
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000023
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026150
Domain Number - Region: 8-88
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0445
Family Rap30/74 interaction domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026150   Gene: ENSCJAG00000014199   Transcript: ENSCJAT00000027634
Sequence length 269
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:19653450:19806767:1 gene:ENSCJAG00000014199 transcript:ENSCJAT00000027634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGVNSVQSASKVRVRTSGSVKYSREDSIRRQSHRSKSMKISNSSEFSAKENKALYNSIK
NEKLEWAVDDEEKKKSPSEGTDEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFL
ARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKHESKLKQITTELAEHRSYPPDKKV
KAKDVDEYKLKDHYLEFEKTRYEIYVSILKEGGKELLSNDESDAAGLKKSHSSPSLNPDT
SPITAKVKRNVSERKDHRPETPSIKQKVT
Download sequence
Identical sequences F7I9J0
ENSCJAP00000026150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]