SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026678 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026678
Domain Number 1 Region: 1055-1149
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-23
Family I set domains 0.0035
Further Details:      
 
Domain Number 2 Region: 767-860
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 863-957
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-21
Family I set domains 0.0067
Further Details:      
 
Domain Number 4 Region: 120-214
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 959-1053
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-20
Family I set domains 0.0035
Further Details:      
 
Domain Number 6 Region: 1151-1238
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-19
Family I set domains 0.0059
Further Details:      
 
Domain Number 7 Region: 409-496
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 311-405
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 215-309
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-17
Family I set domains 0.0095
Further Details:      
 
Domain Number 10 Region: 27-116
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000021
Family I set domains 0.0087
Further Details:      
 
Domain Number 11 Region: 674-764
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000432
Family I set domains 0.0097
Further Details:      
 
Domain Number 12 Region: 580-671
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000439
Family I set domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026678   Gene: ENSCJAG00000014463   Transcript: ENSCJAT00000028198
Sequence length 1327
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:119167724:119183739:-1 gene:ENSCJAG00000014463 transcript:ENSCJAT00000028198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLDRPGEGATMLQTFTILLFCILIDPQPELWIESNYPQAPWENITLWCRSPSQLSSKFL
LLKDKTQMTWIHPSHKTFQVSFLLGALTESNAGLYRCCYWKETGWSKPSKILELEAPGQL
PKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNL
TPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAPGESLNLRCQ
GPIYGMTFALMRVEDLEKSFYHKKTIKNEAYFFFRSLKIQDTGHYLCFYYDGSYRGSLLS
DVLKIWVTDTFPKTWLLARPSPVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDAT
SIDDNTSFILNNVTYSDTGIYSCHYLLTWKTSIRMPSHNIVELMIVDKPPKPSLSAWPST
VFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSEDGDFIISNVDGKGTGTYSCSYRIE
TQPNIWSHRSEPLKLMGPAGYLTWNYILNEAIRLSLLMQLVALLLVALLIQCTFPTLRIT
EAWLLGTAQGVTMLFIVTALLCCGLCNGVLTEETEIVMPTPKPELWAETNFPLAPWKNLT
LWCRSPTGSTKEFVLLKDGTGWIATRPATEQVRAAFPLGALTQSHVGSYHCHSWEEMAVS
EPSEALELVGTDILPKPVISASLPIRGKELQIRCKGWLAGMGFALYKEGKKEPVQQLGAV
GREAFFTIKRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFKTWASPVV
TPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLILSVGIGDGGNYSC
RYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKNVTLRCQGNFQGMRFALLQE
GAQVPLQFQSASGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPLMIWVTDTFP
KPWLFAEPSSVVPMGQNVTLWCQGPVHGVGYILHKEGGATSMQLWGSTSNDGVFPITNMS
AASMGRYSCCYHPDWTSSIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENVTLQCQG
ELPDSTFVLLKKGTQEPLEQQKPSGYRADFWMPAVRGEDSGIYSCVYYLDSAPFAASYHS
DSLEIWVTDKPPKPYLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDG
DFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPLAQECTVGNIVRSTLIV
VVVVALGVVLAVEWKKWPRLRTRGSEADGRDQTIALEECNQEEEPGTPTNSGSSSSQRIS
MELPVPI
Download sequence
Identical sequences F7HPU5
ENSCJAP00000026678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]