SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026803 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026803
Domain Number 1 Region: 88-214
Classification Level Classification E-value
Superfamily Lysozyme-like 1.3e-47
Family C-type lysozyme 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026803   Gene: ENSCJAG00000014561   Transcript: ENSCJAT00000028330
Sequence length 215
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:91503266:91509923:-1 gene:ENSCJAG00000014561 transcript:ENSCJAT00000028330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSALWGAPWIRVCSSPVSSPSASGPLRLVSRLSSQSSALSQSGGGATSFASTEARSRAL
RWRWCPAGTMLLALVSLLSCLFPSSDAKVYGRCELARVLQDFGLDGYRGYSLADWVCLAY
FASGFNTAAVDHEADGSTNNGIFQISSRRWCRNLTPHVPNMCQMYCSDLLNPNLKDTVIC
AMKITQEPQGLGYWEAWRHHCQGKDLTDWVDGCDF
Download sequence
Identical sequences F7I955
XP_002748420.1.60252 ENSCJAP00000026803 ENSCJAP00000051631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]