SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026880 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026880
Domain Number 1 Region: 293-459,755-973,1019-1061
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-106
Family Ras GEF 0.00015
Further Details:      
 
Domain Number 2 Region: 440-526
Classification Level Classification E-value
Superfamily PDZ domain-like 7.89e-20
Family PDZ domain 0.0039
Further Details:      
 
Domain Number 3 Region: 171-295
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.32e-18
Family cAMP-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026880
Domain Number - Region: 665-726
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000475
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026880   Gene: ENSCJAG00000014433   Transcript: ENSCJAT00000028413
Sequence length 1519
Comment pep:novel chromosome:C_jacchus3.2.1:2:73954601:74197090:1 gene:ENSCJAG00000014433 transcript:ENSCJAT00000028413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPARQSRRRFRKINY
KGERQTITDDVEVNSYLSLPADLTKMHLTDNPHPQVTHVSSSQSGCSIASDSGSSSLSDI
YQATESEVGDVDLTRLPEGPVDSEDDEEEDEEIDRTDPLQGRDLVRECLEKEPADKTDDD
IEQLLEFMHQLPAFANMTMSVRRELCSVMIFEVVEQAGAVILEDGQELDSWYVILNGTVE
ISHPDGKVENLFMGNSFGITPTLDKQYMHGIVRTKVDDCQFVCIAQQDYWRILNHVEKNT
HKVEEEGEIVMVHEHRELDRSGTRKGHIVIKATPERLIMHLIEEHSIVDPTYIEDFLLTY
RTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLLWVNNHFNDFEGDPAMTRFLEEFEKNLE
DTKMNGHLRLLNIACAAKAKWRQVVLQKASRESPLQFSLNGGSEKGFGIFIEGVEPGSKA
ADSGLKRGDQIMEVNGQNFENITFMKALEILRNNTHLALTVKTNIFVFKELLCRTEQEKS
GVPHIPKIAEKKSNRHSIQHLPGDIEQASQEKGSKKVKANTVSGGRNKIRKILDKTRFSI
LPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMPIPGTLSSSSPDLLQPTTSMLDFSNPSD
IPDQVIRVFKADQQSCYIIISKDTTAKEVVCHAVHEFGLTGASDTYSLCEVSVTPEGVIK
QRRLPDQFSKLADRIQLSGRFPVKTDIETETLCSDEDAQELVKEAQLSMLQLSTIEVATQ
LSMRDFDLFRNIEPTEYIDDLFKLNSKTGNSHLKRFEDIVNQETFWVASEILTEANQLKR
MKIIKHFIKIALHCRECKNFNSMFAIISGLNLASVARLRGTWEKLPSKYEKHLQDLQDIF
DPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKEI
RQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGGAHKKRARRSSLLNAKKLYEDAQM
ARKVRQYLSSLDVETDEERFQMMSLQWEPAYGTLTKNLSEKKSAKSSEMSPVPMRSAGQT
SKVHLHQPHRVSQVLQVPAVNLYPIRKKGQTKDPALNTSLPQKVLGTTEEISGKKHTEDT
ISVASSLHSSPPASPQGSPHKGYTLTPSAKSDNLSDSSHSEISSRSSIVSNCSVDSMPAA
LQDERCSTQALVIPESTGALEKTEHPSGIGDHSQHGPGYTLLKPSLIKCSAVSSSVSSEE
ISHEHIIIEAADSGRGSWTSCSSSSHDNFQSLPNPKSWDFLNSYRHTHLDDPIAEVEPTD
CEPYSCPKSCSRTCGQCKGSLETNQLRKSWASSSSLSDTYEPNYGTVKRRVLESTPTESS
EGLDPKDATDTVYKTVTSSTEKGLIVYCVTSPKKDDRYREPPPTPPGYLGISLADLKEGP
HPHLKPPDYSVAVQRSKMMHNSLSRLPPASLGCNLVACVPSKIVTQPQRHNLQPSHPKIA
DVTDADSEADAENEQVSAV
Download sequence
Identical sequences F7I1X5
ENSCJAP00000026794 ENSCJAP00000026880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]