SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027157 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027157
Domain Number 1 Region: 50-287
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.53e-89
Family Calponin-homology domain, CH-domain 0.00000243
Further Details:      
 
Domain Number 2 Region: 2347-2457
Classification Level Classification E-value
Superfamily PH domain-like 7.12e-31
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 3 Region: 304-424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-29
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 1537-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 3.32e-29
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 5 Region: 433-535
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-22
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 6 Region: 846-966
Classification Level Classification E-value
Superfamily Spectrin repeat 1.09e-21
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 1750-1902
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-21
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1858-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-20
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 1278-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-17
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 537-643
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-17
Family Spectrin repeat 0.00098
Further Details:      
 
Domain Number 11 Region: 1016-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 6.1e-17
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 12 Region: 729-823
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 13 Region: 1452-1577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000115
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 14 Region: 604-721
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000563
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 15 Region: 2016-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000331
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 16 Region: 1386-1484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000115
Family Spectrin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027157   Gene: ENSCJAG00000014669   Transcript: ENSCJAT00000028710
Sequence length 2498
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:33879885:33989605:1 gene:ENSCJAG00000014669 transcript:ENSCJAT00000028710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEPGEVDNMEGLPAPNNNNPAARWESPDRGWEREQLAASTAAASLFECSRIKALADER
EAVQKKTFTKWVNSHLARVGCHIGDLYVDLRDGFVLTRLLEVLSGEQLARDTAGRMRIHS
LENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIETEDNRET
RSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHRHRPDLVDFSKLTKSNANY
NLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSFYHYFSKMKALAVEGKRIGK
VLDQVLEVGKIIDRYEELAAELLAWIHRTVGLISNQKFANSLSGVQQQLQAFTAYCTLEK
PVKFQEKGNLEVLLFSIQSKLRACNRRLFVPREGCGIWDIDKAWDELEKAEHEREAALRA
ELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNFGYELPAVEAAMKKHEAIEADIA
AYEERVQGVAELAQALAAEGYYDVRRVAAQRDSVLRQWALLTGLVGARRTRLEQNLALQK
VFQEMVYMVDWMEEMQAQLLSRECGQHLVEADDLLQKHGLLEGDIAAQSERVEALNAAAL
RFSQLQGYQPCDPQVICNRVNHVHGCLAELQEQAARRRAELEASRSLWALLQELEEAESW
ARDKERLLEAAGGGGAAGSAGGAHDLSSTARLLAQHKILQGELGGRRALLQQALRCGEEL
ETMQLVGLAERAASARRRWQRLEEAAARRERRLQEARALHQFGADLDGLLDWLRDAYRLA
AAGDFGHDEASSRRLARQHRALTGEVEAHRGPVSGLRRQLASLGGASGAGPLVVALQVVR
VVEAEQVAEVTEVAALRRQWLRDALAVYRMFGEVHACELWIGEKEQWLLSMRVPDSLDDV
EVVQHRFESLDQEMNSLMGRVLDVNQTVQELVEGGHPSSDEVRSCQDHLNSRWNRIVELV
EQRKEEMSAVLLVENHVLEVAEVRAQVREKRRAVELQWRLSGLEAALQALEPRQAALLEE
AALLAARFPTQAARLHQGAEELGAEWGALASAAQACGEAVAAAGRLQRFLHDLDAFLDWL
VRAQEAAGGSEGPLPNSLEEADALLARHAALKEEVDQREEDYARIVAASEALLASDGAEL
GPGLALDEWLPHLELGWHKLLGLWEARREALVQAHIYQLFLRDLRQALAVLCNQSFLFSG
GRDAGVVSVVLSPSWRLRVFLTSMTDASQFGYQFGYVRPGGIDFSSISEAFRLSWLLRNQ
ENQLRAQQWMQKLHDQLELQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQA
FMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFE
ASKADQLVQSFAELDKKLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWYREVGE
LQAQTAALPLEPASKELVGERQNAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDEL
VRPPQXMQTERGDGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERASALASLRSPEAEAV
RRGLEQLQSAWAGLREAAERRQQALDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKD
EQSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVAL
KELGEERRVALEQQYWLYQLSRQVGELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEF
ANETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAA
SRELHKFFSDARELQGQIEEKRRRLPRLTTPPEPRPSASSMQRTLRAFEHDLQLLVSQVR
QLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLSACEDARLHVSSTADALRFHSQVR
DLLSWMDGIASQIGAADKPRDVSSVEVLINYHQGLKTELEARVPELTACHELGRSLLLNK
SAMTDEIQAQLDKLGTRKEECAHVAQGHRDMLQRVHEVHQFAQEAVVADAWLTAQEPILQ
SRELGSSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRK
FFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRI
DRLPEIPGRVEPAVPPAAPEDAAETPATPVAPVVAEQVRPRPERQESADRAEELPRRRRP
ERQESVDQSEEAARRRRPERQESAEHEAAHSLTLGRYEQMERRRERRERRLERQESSEQE
MPIRGDLVKGKATLADIVEQLQEKEAGPGLPAGPSLPQPRELPPGRLPNGLEPPERTREG
GEGGAPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASG
STHGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVAVSV
AEHAEIARWSQTLPTTSSTDEGNPKREGGDRRASGRRK
Download sequence
Identical sequences F7HAK3
ENSCJAP00000027157 ENSCJAP00000027118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]