SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027475 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027475
Domain Number 1 Region: 310-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000229
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 254-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 373-413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000254
Family Laminin-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027475   Gene: ENSCJAG00000014914   Transcript: ENSCJAT00000029041
Sequence length 463
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:2152130:2154148:-1 gene:ENSCJAG00000014914 transcript:ENSCJAT00000029041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWPWELLLTAGTLSAALSPGPPAPADPCHDEGGAPRGCVPGLVNAALGREVLASSTCG
RPATRACDASDPRRAHPAALLTSAGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV
SLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCGLDYGRLPAPAIGPAGPGPEALCFPA
PQAQPDGSGLLAFSMQDSSPPGLDLDSSPVLQDWVTATDIRIELTRPSAVGNPRDSESLS
YSYAATDLQVGGRCKCNGHASRCLLDAQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRAT
AREPHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCQEGFYRDP
GRALSDRRVCRACDCHPVGAAGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPC
VKTPIPGPTEDSSPAQPQDCDSHCRPARGSYRISLKKFCRKDY
Download sequence
Identical sequences F7FT60
ENSCJAP00000027475 ENSCJAP00000027475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]