SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028769 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028769
Domain Number 1 Region: 24-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-91
Family Protein kinases, catalytic subunit 0.000000531
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000028769
Domain Number - Region: 444-483
Classification Level Classification E-value
Superfamily NAP-like 0.0209
Family NAP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028769   Gene: ENSCJAG00000015597   Transcript: ENSCJAT00000030399
Sequence length 491
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:95715671:96078869:1 gene:ENSCJAG00000015597 transcript:ENSCJAT00000030399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
Download sequence
Identical sequences A0A2K5DK10 F7A3C1 H2PQW7 H2QWH8
XP_002759408.1.60252 XP_009242249.1.23681 XP_012311233.1.9421 XP_528201.3.37143 ENSCJAP00000028762 ENSPTRP00000034983 ENSCJAP00000028769 ENSPTRP00000034983 ENSPPYP00000021064 ENSPPYP00000021064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]