SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028953 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028953
Domain Number 1 Region: 1305-1382
Classification Level Classification E-value
Superfamily Immunoglobulin 3.67e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 922-995
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000088
Family I set domains 0.049
Further Details:      
 
Domain Number 3 Region: 1204-1282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000255
Family I set domains 0.027
Further Details:      
 
Domain Number 4 Region: 705-758
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000301
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 419-479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000759
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 6 Region: 474-534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000128
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 570-624
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1422-1479
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000011
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 758-818
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000484
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 814-879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 12 Region: 1483-1540
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 13 Region: 1596-1651
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 
Domain Number 14 Region: 341-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 646-702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000471
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028953   Gene: ENSCJAG00000015699   Transcript: ENSCJAT00000030594
Sequence length 1687
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:23310032:23750798:1 gene:ENSCJAG00000015699 transcript:ENSCJAT00000030594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWMSPWWLLIGMVFMYCTLLQTTAEKSPGAYFLPEFALSPQGSFLEDTTGEQFLTYRY
DDQTSRNARSDEDKDGNWDAWGDWSDCSRTCGGGASYSLRRCLTGRNCEGQNIRYKTCSN
HDCPPDAEDFRAQQCSAYSDVQYQGHYYEWLPRYNDPAAPCALKCHAQGQDLVVELAPKV
LDGTRCNTDSLDMCISGICQAVGCDRQLGSSAKEDNCGVCAGDGSTCRLVRGQSKSQVSP
EKREENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVIENTTVEFQK
GSERQTFKILGPLMADFIFKTRYTAAKDSMVQFFFYQPISHQWRQTDFFPCTVTCGGGYQ
LNSAECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLP
RWEHNPWTSCSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCP
KWIAMEWSQCTVTCGRGLRYRVVLCINHHGEHVGGCNPQLKLHIKEECVIPIPCYKPRGK
SVLHCKFKSNDIFQLSLSGGSLVSPRFIPEPWSACSTTCGSGVQVREVKCRVLLTFTQTE
TELPEEECEGPKLPTERPCLLEACDESPASQELDIPLPEDSETTYDWEYAGFTPCTATCL
GGHQEAIAVCLHIQTQQTVNDSLCDMIHRPPAMSQACNTEPCPPRWHMGSWGPCSATCGV
GIQTRDVYCLHPGENPASPEECQDEKPHALQACNQFDCPPGWHIEEWQQCSRTCGGGTQN
RRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHLAVGDWSKCSVSCGVGIQR
RKQVCQRLTAKGRRVPLSEMMCRDLPGLPLVRSCQMPECSNIKSEMKTKLGEQGPQILGV
QRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLGI
TKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKLIGTDNRLIARPALREPMREYPGMDHN
EAKSLGVTWHKMRQIWNNKNELYPDDDHINNQPFLRALLGHCRNSAGNSNSWELKNKQFE
AAIKQGAYSMDTAQFDELIRNMSQLMETREVSDDLASQLIYQLVAELAKSHMQWRGIQEE
MPPAAQLRGETGSVSQSSNAKNSGKLTFKPKGPVLMRQSQPPSISFNKTINSRIGNTVYI
TKRTEVINILCDLITPSEATYTWTKDGTLLQPSEKIILDGTGKIQIQNPTRKEQGIYECS
VANYLGSDVESSSVLYAEAPVILSTERNITKPEHNHLSVIVGGIVEAALGANMTIRCPVK
GVPQPNITWLKRGGSLSDNVSLLFNGSLLLQNISLENEGTYICTATNALGKAVATSVLHL
LERRWPESKIVFPQGHKKYILQATNTRTNISDPTGEPLPQEPFWEAGNWSHCSATCGHLG
ARIQRPQCVMANGQEVSEALCDHLQKPLAGFQPCNIRDCPARWFTTVWSRCSVSCGEGYH
SRQVTCKQTKANGTVQVVSPRACAPKDRPLGRKPCSGHPCVQWEPGSQCPGRCMGGAVRM
QQRHTACQHNSSDSNCDDRRRPTLRRNCTSGACDVCWLAGPWKPCTAACGRGFQSRKVDC
IHTRSCKPVAKRHCVQKEKPASWRHCLGPSCDRDCTDTTHYCMFIKHLNLCSLDLYKQRC
CRSCQEG
Download sequence
Identical sequences F7BM23
ENSCJAP00000028942 ENSCJAP00000028953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]