SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029909 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029909
Domain Number 1 Region: 337-465
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-26
Family Ran-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029909   Gene: ENSCJAG00000016242   Transcript: ENSCJAT00000031605
Sequence length 468
Comment pep:novel chromosome:C_jacchus3.2.1:1:204785954:204809278:1 gene:ENSCJAG00000016242 transcript:ENSCJAT00000031605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTERNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRSVGFESDSGGAFKG
FKGLVVPSGGGRFPGFGSSAGGKPLEGISNGNNVTSAPPFTSARAAAEPKVAFGSLAANG
PTSLVEKKVSNPKTNGDSQQPSSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLANIEQQHGDGGSNSESESNKTAVETQSLSLFGSTKLQQESVFLFH
GNKTEDTPEKKVEVAAEKKTDPSLGATSASFNFGKKVDSSVVGSLSSVPLTGFSFSPGNS
SLLGKDITQSKPVSSPFPAKPLEGQVEGDSSECKGGDEEESDEPPKVVVTEVKEDDAFYS
KKCKLFYKKDNEFKEKGIGTLHLKPTVNQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG
KNNVLIVCVPNPPIDEKNATVPVTMLIRVKTSEDAEELHKILLEKRDA
Download sequence
Identical sequences F7IC26
XP_008978303.1.60252 XP_017819573.1.60252 XP_017819578.1.60252 ENSCJAP00000029909 ENSCJAP00000029909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]