SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029955 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029955
Domain Number 1 Region: 173-279
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000899
Further Details:      
 
Domain Number 2 Region: 41-148
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 457-560
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 328-432
Classification Level Classification E-value
Superfamily SRCR-like 1.15e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029955   Gene: ENSCJAG00000016269   Transcript: ENSCJAT00000031656
Sequence length 561
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:9326752:9347721:-1 gene:ENSCJAG00000016269 transcript:ENSCJAT00000031656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGGGGWEGSAAPPLLPQALSFLLLLPLASALQLTPLPFPELRLVGGPSRCRGRLEVM
HGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPILLDNVECRGQEAAL
SECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRRMLTSRAPPRTLPNGKSEGSVRLVGG
ANPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQLGCGVAMAATTNAFFGYGTGHILLD
NVHCEGSEPHLAACQSLGWGVHNCGHHEDAGALCTGLGPPTLTALPSLATREDWAWRTDP
SATGVAPQPSRETALLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVLYAGGWGTVCDDDWD
FADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCSGTEARLSDCFHLGWGQHNCG
HHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGRVELYLGQRW
GTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSH
IRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences F7I7A2
ENSCJAP00000029955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]