SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030107 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030107
Domain Number 1 Region: 99-131,212-286
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.04e-16
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030107   Gene: ENSCJAG00000016357   Transcript: ENSCJAT00000031816
Sequence length 341
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:76332536:76357893:1 gene:ENSCJAG00000016357 transcript:ENSCJAT00000031816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRHRLAVPSVLAAVVIANLKGMFMQVCDVPRLWRQNKTDAVIWVFTCIVSIILGLDLGLL
AGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNV
DGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKNGQLRATKNGIVSDAGSTNNAFEPDE
DIEDLEELDIPTKEIEIRVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDIVGVKSLRVI
VKEFQRIDVNVYFASLQDHVIEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQGGQ
DSILEAITFIQDCKDPLELIEAELTEEELDVQDEAMRTLAT
Download sequence
Identical sequences F6WCS4
ENSCJAP00000030107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]