SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030583 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030583
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.78e-17
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030583   Gene: ENSCJAG00000016602   Transcript: ENSCJAT00000032318
Sequence length 258
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:41714261:41721109:1 gene:ENSCJAG00000016602 transcript:ENSCJAT00000032318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEEGEDLQSCMICVARRITTGERVYPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFE
DIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRN
PVTNDRHGFVSTHFLQREQNGYRTNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSS
RAYGLADPSTTGQMSGARYGGSSNIASVTSGPGMQSPSSYQNNNYGLNMSSPPHGSPGLA
PNQQNIMILLVIVGVQRW
Download sequence
Identical sequences F6V5H5
ENSCJAP00000030583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]