SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030992 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030992
Domain Number 1 Region: 315-351
Classification Level Classification E-value
Superfamily PH domain-like 0.000000467
Family Ran-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030992   Gene: ENSCJAG00000016791   Transcript: ENSCJAT00000032750
Sequence length 398
Comment pep:novel chromosome:C_jacchus3.2.1:22:5633541:5696140:-1 gene:ENSCJAG00000016791 transcript:ENSCJAT00000032750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLANEEKPAIAPPVFVFQKDKGQKRSAGGSSPEGGEDSDREDGNYCPPVKRERTSSLT
QFPPSQSEERSSGFRLKPPTLIHGQAPSAGLPSQKPKEQQRSVLRPAVLQAPQPKALSQT
VPSSGTNGVSIPADCTEAVPAASPDNPARRSPSEAADEVCALEEKEPQKNESGNASEEEA
CEKKDPATQQAFVFGQNLRDRVKLINESADEADMENAGHPSADTPAATNYFLQYISSSLE
NSTNSADASSNKFVFGQNMSERVLSFPKLNEVSSDASRENAAAESGSESSSQEATPEKES
LAESAAAYTKATARKCLLEKVEVITGEEAESNVLQMQCKLFVFDKASQSWLCRRPHPSLP
AAAPRPCGEQPLAFCLRPGVSNYRPGTPAQPGELLTRV
Download sequence
Identical sequences F6V172
ENSCJAP00000030992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]