SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031220 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031220
Domain Number 1 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000803
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 167-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 131-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000622
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000031220
Domain Number - Region: 210-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 57-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 29-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.048
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031220   Gene: ENSCJAG00000016972   Transcript: ENSCJAT00000032995
Sequence length 310
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:126621979:126630423:1 gene:ENSCJAG00000016972 transcript:ENSCJAT00000032995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTHGAECVPACHPQNGLCEDDNVCRCQPGWQGPLCDQCMTS
PGCLHGLCEEPWQCVCIDGWDGKLCDIDVRACSSAPCANNGTCVNLDNGLYQCSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NEGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASGPCQNGATCLQHTQGQAICFTILGVL
TSLVVLGTVGIIFLNKCETWVSNLRYNHMLRKKKNLLLQCSSGEDLAVNIIFPEKIGMAT
FRKEAGDEEI
Download sequence
Identical sequences F7IF43
ENSCJAP00000031220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]