SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031236 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031236
Domain Number 1 Region: 89-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000704
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 172-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000156
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000031236
Domain Number - Region: 56-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00052
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 29-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0453
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031236   Gene: ENSCJAG00000016972   Transcript: ENSCJAT00000033012
Sequence length 315
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:126622139:126630197:1 gene:ENSCJAG00000016972 transcript:ENSCJAT00000033012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTHGAECVPACHPQNGLCEDDNVCRCQPGWQGPLCDQCMTS
PGCLHGLCEEPWQCVCIDGWDGKLCDIDVRACSSAPCANNGTCVNLDNGLYQCSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NEGVCTDIGGDFRCRCPAGFIDKTCSRPVQQPEHRVLKVSMKELNKSTPLLTEGQAICFT
ILGVLTSLVVLGTVGIIFLNKCETWVSNLRYNHMLRKKKNLLLQCSSGEDLAVNIIFPEK
IGMATFRKEAGDEEI
Download sequence
Identical sequences F7ICS7
ENSCJAP00000031236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]