SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000031741 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000031741
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-24
Family Pyrin domain, PYD 0.0026
Further Details:      
 
Domain Number 2 Region: 597-670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-24
Family SPRY domain 0.00077
Further Details:      
 
Domain Number 3 Region: 369-434
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000142
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000031741   Gene: ENSCJAG00000019582   Transcript: ENSCJAT00000033552
Sequence length 690
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:3288233:3304589:-1 gene:ENSCJAG00000019582 transcript:ENSCJAT00000033552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKKHSRIPRGQIQTARPVKMASLLVTY
YGEEYAVRLTLQVLRAMNQRLLAEELHRAAVQEYSAEESGTDCSAASLKPEPRSLKTLDD
LPEGKERSCPRQCGDGAANPRCPQPEAGGGCLGRGLPRKAPGKHREIASEGLDTQGKPRT
RTQSPALTSGRSPSRAREGVQAQVQLRRNASSAGRLQGLAGGTLGRRECRAFEVNQPSGK
KRPKSLEFTVSTGEKAPPNPEILLTLEEMRAVNPDLAAASQAGSTPDGGASADPGEGSGN
PERLVTGRPPDKAASPHCHTQEGGPVGGTCLHDSCSCPQAASGHPEATGSCTPGCPRCQA
SHERKSTGSLSPQPLPQCKRHLKQVQLLFCKDHGEPICLICSMSQEHRGHQMCPIEEAAL
EHKEQIQEQLKYLKKLRTSGEEERSYGNEKAASFLKQTEMLKQRVQRKLEQLYHFLEQQE
HVFVASLEDLGQMVGQFKKAYDTRVSRDIALLDTLIGELEAKQCQSEWELLQDFGDILHR
AKKVPVPQRWTPPEEIKEKIHLLHQKSEFVEKSAKYFSETLRLEMEMFNVPELTGAQAHA
VNMILDAETANPNLVFSDDLKSVRLGNQWERLPDGPERFDSCILALGSPSFISGRHYWEV
EVGDKRFSCLSLLNSWDYRCPTCLANFLYF
Download sequence
Identical sequences F7HVY3
ENSCJAP00000031741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]