SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032395 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032395
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 9.59e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1079-1192
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-18
Family SPRY domain 0.029
Further Details:      
 
Domain Number 3 Region: 3997-4075
Classification Level Classification E-value
Superfamily EF-hand 0.000000000762
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 657-805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000673
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 98-180
Classification Level Classification E-value
Superfamily MIR domain 0.00000405
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 419-546
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000157
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 
Domain Number 7 Region: 2145-2210
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000981
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000032395
Domain Number - Region: 1410-1531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000594
Family SPRY domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032395   Gene: ENSCJAG00000017504   Transcript: ENSCJAT00000034238
Sequence length 4956
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:42547954:43120875:-1 gene:ENSCJAG00000017504 transcript:ENSCJAT00000034238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKWSCSAPQPSTKSSRSYAWQQKDLATDFVSWSPLPTPRMYPRTSPSAHSCWSSPSLSG
PCRRCWLTPWRNQKGQVPDLSHWGMFLKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLST
SRSSTDKLAFDVGLQEDATGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLS
YGNGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEE
QRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLL
LMDKEKADVKSTAFTFRSSKEKLDVGVRKEVDGMGTSEIKYGDSVCYIQHVDTGLWLTYQ
SVDVKSVRMGSIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIRSTVFLFNRFIRGLDA
LSKKAKASTVDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMI
NLVLDCIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSL
DWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLC
SLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYY
ELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSG
CIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFS
AGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTV
SLTQAAFTPIPVDTHQIVLPPHLERIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQH
PCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSG
YKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPY
TLLDDRTKKSNKDSLREAVRTLLGYGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYA
VKAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFAFDGFKAQRWHQGNEHYGRS
WQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRM
NFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDG
TIDSSPCLKVTQKSFGSQNSNTDIMFYRLSMPIECAEVFSKTVPGGLPGAGLFGPKSDLE
DYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKP
DYSTSHSARLTEDVLADDRDDYDFLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDT
GFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAAS
GLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEH
KNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEE
NRSVDILELTEQEELLKFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMP
GLLRTGYYDLLIDIHLSSYATARLMMNNEYIVPMTEETKSITLFPDENKKHGLPGIGLST
SLRPRMQFSSPSFVSISNECYQYSPEFPLDILKAKTIQMLTEAVREGGLHARDPVGGTTE
FLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAATLEEESDALEKELHVEDARL
QGAGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAK
LQDNQRFRYNEVMQALNMSAALTARKTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQ
LLDFHEDLMTHCGIELDEDGSLDGNSDLTIRGRLLSLVEKVTYLKKKQAEKPIESDSKKS
STLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVED
TINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVM
VNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMR
GSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEG
ERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAE
DPSRDGPSPNSGSSKTLDTEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGE
AIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRV
YGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLF
AGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFD
VPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQK
KYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPE
KLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPI
KESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSR
DLHAMAEMMAENYHNIWAKKKKMELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKF
LQINGYAVSRGFKDLELDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRGKGEHFP
YEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLV
RHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENL
KQGQFTHTRNQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILT
SLYALGTSKSIYVERQRSALGECLAAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAAL
SLPSNVEDVCPNIPSLEKLMEEIVELAESGIRYTQIPHVMEVILPMLCSYMSRWWEHGPE
NNPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLL
KTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIR
FVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDT
KSKMSKAAVSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNR
FSLKDTEDEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTDDASDPEKTVERVLDIA
NVLFHLEQKSKRVGRKHYCLGSTVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLP
RHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGADPPEEDECTKRVDPLHQLILLFS
RTALTEKCKLEEDFLYMAYADIMAKSCHDEEDNDGEEEVKSFEEKEMEKQKLLYQQARLH
DRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQS
LAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNS
DFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQV
AKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELM
DLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTF
KEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAK
DIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEI
SESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLN
ERSANKEESEKERPEEQGPRMGFFSILTVKSALFALRYNILTLMRMLSLKSLKKQMKKVK
KMTMKDMVTAFFSSYWSIFLTLLHFVASVFRGFFRIICSLLLGGSLVEGAKKIKVAELLA
NMPDPTQDEVRGDGEEGERKALEATLPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYK
LIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEGKEEREETKSEPEKAEGEDGEKEEK
VKEDKGKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFA
INFILLFYKVSTSSVVEGKELPTRSSSENAKVTSLDSSSHRIIAVHYVLEESSGYMEPTL
RILAILHTVISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDR
LVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDS
SFSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKT
LRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTC
YMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGNRLIIDAF
GELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDE
TEHTGQVEALNMYQERCWEFFPAGDCFRKQYEDQLN
Download sequence
Identical sequences F7FIY3
ENSCJAP00000032395 ENSCJAP00000032439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]