SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000032813 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000032813
Domain Number 1 Region: 176-341
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.72e-38
Family Dual specificity phosphatase-like 0.0000123
Further Details:      
 
Domain Number 2 Region: 354-482
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.41e-37
Family PLC-like (P variant) 0.0018
Further Details:      
 
Domain Number 3 Region: 35-176
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000011
Family Voltage-gated potassium channels 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000032813   Gene: ENSCJAG00000017791   Transcript: ENSCJAT00000034679
Sequence length 483
Comment pep:novel chromosome:C_jacchus3.2.1:5:154070620:154134167:-1 gene:ENSCJAG00000017791 transcript:ENSCJAT00000034679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMAEQLSRFEDEEGTDVTAYDSKIKKIAHSIVSSFAFGIFGVCLLLLNVGLIFADLIFAE
KKIYMPLEYRCISPSIAIFFLMDILLRVFVDGRQHYFSGLCNILDIAIIVITLLTDVIYI
FFDFKFLSDIPRWTPVVRHLRLIILTRIVHLVHQKRQLEKLIRRLVSENKRRYVRNGFDL
DLTYVTERIIAMSFPSSGRRSYYRNPIEEVVRFLDKKHPNHYRVYNLCSERAYDPKHFHN
RVSRILIDDHNVPTLHEMVVFSKEASEWMAQDPENIIAIHCKGGKGRTGTMVCACLIASE
IFLTAKESLCYFGERRTDKTNSTKFQGVETPSQNRYVGYFAQVKYHYNWNVPPERILFIK
RFIIYSLHGDENDLKVQIVMEKSVVFSCTSLKNCVVIHDAETDRVIIDVLNCPPLYDDVK
VQFFSSELPKYYDNCPFFFWFHTSFIQDNRLYLPRNELDNPHKPKTWKIYPPEFAVEIIF
EEK
Download sequence
Identical sequences F7EQN0
ENSCJAP00000032813 ENSCJAP00000032813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]