SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000033219 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000033219
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000113
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 127-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000365
Family EGF-type module 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000033219
Domain Number - Region: 169-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000884
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000033219   Gene: ENSCJAG00000017963   Transcript: ENSCJAT00000035105
Sequence length 331
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:117448061:117531047:-1 gene:ENSCJAG00000017963 transcript:ENSCJAT00000035105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQ
QLCANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPDMNL
RRRYGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNH
TCNLQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVS
GRSVPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQ
LDLEMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences F6RCC1
ENSCJAP00000033219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]