SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034588 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034588
Domain Number 1 Region: 32-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000144
Family HLH, helix-loop-helix DNA-binding domain 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034588   Gene: ENSCJAG00000018614   Transcript: ENSCJAT00000036526
Sequence length 182
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:97725925:97800473:1 gene:ENSCJAG00000018614 transcript:ENSCJAT00000036526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPRLQHSKPPRRLSRAQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTL
GLLNKAKAHIKKLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTIS
SDRSDSEREEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSF
TS
Download sequence
Identical sequences F7I3Q0
ENSCJAP00000034588 XP_004659413.1.11716 XP_005894828.1.15283 XP_007446578.1.90284 XP_007939735.1.48129 XP_012659120.1.62490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]