SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034701 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034701
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.33e-35
Family SCAN domain 0.0000457
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 514-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 214-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000209
Family KRAB domain (Kruppel-associated box) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034701   Gene: ENSCJAG00000018671   Transcript: ENSCJAT00000036647
Sequence length 578
Comment pep:novel chromosome:C_jacchus3.2.1:4:865381:877337:-1 gene:ENSCJAG00000018671 transcript:ENSCJAT00000036647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPPGQELFRLRFRQLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVSARVRGHRVLWEEVVHSESAPEPPSTQLQSEASQHKSPVS
QESQERAMPTSQSPTSSQKGSSGNQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDPSQ
KDLSRDNRPENVRNMFSLGGETRSENRELASKQVISTGIQQHGETAAKCNGDVIGGLEHG
EARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFS
YRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGH
QRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIH
TGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESAGV
Download sequence
Identical sequences F7IFF1
XP_008992017.1.60252 XP_008992019.1.60252 XP_017826313.1.60252 ENSCJAP00000034701 ENSCJAP00000050071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]