SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035840 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035840
Domain Number 1 Region: 2-173,210-266
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.98e-37
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 
Domain Number 2 Region: 385-527
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.45e-21
Family Glycerol-3-phosphate transporter 0.052
Further Details:      
 
Domain Number 3 Region: 290-368
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000051
Family Pentapeptide repeats 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035840   Gene: ENSCJAG00000019298   Transcript: ENSCJAT00000037848
Sequence length 531
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:16144822:16340918:-1 gene:ENSCJAG00000019298 transcript:ENSCJAT00000037848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVYLGMMAGAFILGGLADKLGRKRVLSISLAVNASFASLSSFVQGYGAFLFCRLISGIG
IGGALPIVFAYFSEFLSREKRGEHLSWLGIFWMTGGLYASAMAWSIIPHYGWGFSMGTNY
HFHSWRVFVIVCALPCTVSMVALKFMPESPRFLLEMGKHDEAWMILKQVHDTNMRAKGTP
EKVFTVSNIKTPKQMDEFIEIQSSTGTWYQRWLVRFKTIFKQVWDNALYCVMGPYRMNTL
ILAVVWFAMALSYYGLTVWFPDMIRYFQDEEYKSKMKYFGEHVYGATINFTMENQIHQHG
KLVNDKFTRMYFKHVLFEDTFFDECYFEDVTSTDTYFKNCTIESTIFYNTDLYEHKFINC
RFINSTFLEQKEGCHMDLEQDNDFLIYLVSFLGSLSVLPGNIISALLMDRIGRLKMIGGS
MLISAVCCFFLFFGNSESAMIGWQCLFCGTSIAAWNALDVITVELYPTNQRATAFGILNG
LCKFGAILGNTIFASFVGITKVVPILLAAASLVGGGLIALRLPETREQVLM
Download sequence
Identical sequences F7H7I0
ENSCJAP00000035840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]