SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035892 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035892
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-78
Family Calponin-homology domain, CH-domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 963-1118
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-17
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 4 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 2.73e-16
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000346
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 6 Region: 426-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000327
Family Spectrin repeat 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000035892
Domain Number - Region: 689-757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00626
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035892   Gene: ENSCJAG00000019315   Transcript: ENSCJAT00000037904
Sequence length 1121
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:144969189:145166578:1 gene:ENSCJAG00000019315 transcript:ENSCJAT00000037904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLLQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHQHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVSIDAIREVETLPRKYKKECEEEAINIQSTAPEEERESPRAET
PSTVTEVDTDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLTDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSTWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWSRLQEINVLWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGISQIPQKDLLETVRVRE
QVTTKKSKQELPPPPPPKKRQIHVDIEAKKKFDAMSAELSNWIVKSKTAIQTTEIKEYKK
IQDTSEMKKKLKVLEKEQRERIPRLDELNQIGQIVVEQMGKEGLPTEEIKNVLEKVLSEW
KNVSQHLEDLERKIELQEDINAYFKQLDELEKVIKTKEEWVKHTSVSESSRQSLPSLKDS
CRRELTNLLGLRPKIEMARASCSALKSQPSAPDFVQQGFDSFLGCYQAVQKALEDRQQQL
ENEPKVQPGHAYLETLKTLRDELRDSENKAQASLSVLNDLAKVEKALQEKKALDEILENQ
KPTLYKLADETKALEKNVHPDVEKLYKQEFDIVQGQWNKLKVLVSKDVHLLEEIILKLRA
FEADSTIIEKWIDGVKDFLMKQQAAQGDDTDLQRQLDQCSAFVNEIETIESSLKSMKEIE
TNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEFAKQWSRIT
Download sequence
Identical sequences F7GRY9
ENSCJAP00000035892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]