SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035924 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035924
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.14e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000035924
Domain Number - Region: 160-191
Classification Level Classification E-value
Superfamily ARM repeat 0.000193
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 210-292
Classification Level Classification E-value
Superfamily HRDC-like 0.0262
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035924   Gene: ENSCJAG00000019334   Transcript: ENSCJAT00000037938
Sequence length 296
Comment pep:novel chromosome:C_jacchus3.2.1:2:68943299:68959402:-1 gene:ENSCJAG00000019334 transcript:ENSCJAT00000037938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSMSGKRSAPGGGSKVPQKKVKLAADEDDDDDEDDDDDDDEDDDD
DDFDDEETEEKVPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTP
KGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences F7FL37
XP_002744589.1.60252 ENSCJAP00000035920 ENSCJAP00000035924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]