SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035998 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035998
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.08e-77
Family Calponin-homology domain, CH-domain 0.00000048
Further Details:      
 
Domain Number 2 Region: 2843-2967
Classification Level Classification E-value
Superfamily EF-hand 1.71e-49
Family EF-hand modules in multidomain proteins 0.00000617
Further Details:      
 
Domain Number 3 Region: 2969-3064
Classification Level Classification E-value
Superfamily EF-hand 2.27e-38
Family EF-hand modules in multidomain proteins 0.0000154
Further Details:      
 
Domain Number 4 Region: 1924-2080
Classification Level Classification E-value
Superfamily Spectrin repeat 1.59e-25
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 3044-3132
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-20
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 2506-2637
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 387-526
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-16
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 494-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000108
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 2282-2440
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000282
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 2053-2179
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000432
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 12 Region: 2683-2802
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000131
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 13 Region: 743-901
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000166
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 14 Region: 1181-1333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000216
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 15 Region: 963-1083
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000023
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 16 Region: 1492-1647
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000115
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 17 Region: 2805-2842
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 18 Region: 1620-1745
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000024
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 19 Region: 1083-1192
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000252
Family Spectrin repeat 0.007
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000035998
Domain Number - Region: 1414-1509
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00222
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 1306-1397
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0122
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 2234-2300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number - Region: 689-757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0446
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035998   Gene: ENSCJAG00000019315   Transcript: ENSCJAT00000038013
Sequence length 3434
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:144969189:145555594:1 gene:ENSCJAG00000019315 transcript:ENSCJAT00000038013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
KDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLLQNNVELVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWT
DGLAFNAVLHQHKPDLFSWDKVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVSIDAIREVETLPRKYKKECEEEAINIQSTAPEEERESPRAET
PSTVTEVDTDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLTDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM
ELQKKQLQQLSTWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSL
THMVVIVDENSGESATAILEDQLQKLGERWTAVCRWTEERWSRLQEINVLWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQL
LDNSKASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGISQIPQKDLLETVRVRE
QVTTKKSKQELPPPPPPKKRQIHVDIEAKKKFDAMSAELSNWIVKSKTAIQTTEIKEYKK
IQDTSEMKKKLKVLEKEQRERIPRLDELNQIGQIVVEQMGKEGLPTEEIKNVLEKVLSEW
KNVSQHLEDLERKIELQEDINAYFKQLDELEKVIKTKEEWVKHTSVSESSRQSLPSLKDS
CRRELTNLLGLRPKIEMARASCSALKSQPSAPDFVQQGFDSFLGCYQAVQKALEDRQQQL
ENEPKVQPGHAYLETLKTLRDELRDSENKAQASLSVLNDLAKVEKALQEKKALDEILENQ
KPTLYKLADETKALEKNVHPDVEKLYKQEFDIVQGQWNKLKVLVSKDVHLLEEIILKLRA
FEADSTIIEKWIDGVKDFLMKQQAAQGDDTDLQRQLDQCSAFVNEIETIESSLKSMKEIE
TNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEISTQKSRLSESQEKAVNLKKDLAEMQEW
MTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGG
QELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKNTE
VLPEKMDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEE
LSHLAESKQISLEKQLQVLRETDHILQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKI
QAEISARELTLEELRRNMRSQPPTSPESRSARGGSQMDVLQRKLREVSTKFQLFQKPANF
EQRMLDCKRVLDGVKAELHVLDVKDVDPDVIQTHLDKCMKLYKTLSEVKLEVETVIKTGR
HIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLERASQLARKMKKEAASLSEWL
SATETELVQKSTSEGLLGDLDTEISWAKNVLKGLEKRKADLNTITESSATLQNLIEGSEP
ILEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK
KPASKREEIVKRLVSELDDANLQVENVRDQAVILMNARGSSSRELVEPKLAELNRNFEKV
SQHIKSAKLLIAQEPLSYQCLVTTETFETGVPFSDFEKLENDIENMLKVVEKHLESSDED
EKMDEERAQIEEALQRGEQMLHQPMEDNKKEKIRLQLLLLHTRYNKIKAIPIQQRKIGQL
ASGMRSSLLPTDYLVEINRILLCMDDVELSLNIPELNTAVYEDFSFQEDSLKNIKDQLDK
LGEQIAVIHEKQPDVILEASGPEAIQIRDALTQLNAKWDRINRMYGDQKGYFDRAMEEWS
QFHCDLNDLTQWITETEELLVDTCAPDGSLDLEKARVHQQELEEGISSHQPSFAALNRTG
DGIVQKLSQADGSFLKDKLAGLNQRWDAIIAEVKDRQQRLKGENKQVMEYRHQLDELICW
LTKAEHAVKKRSTTELGENLQDLRDLTQEMEVHAEKLKWLNRTELEMLSDKSLSLPEREK
ISESLRTVNTTWNKICREVPTTLKERIQEPSSISQTRIAAHPSVQKVVLVSSASDTPVQS
HRTSGISIPADLDKTITELADWLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQR
HPQLDYVFTLAQNLKNKASSSDVRTAITEKLEKVKNQWDGTQHGVELRQQQLEDMIIDSL
QWDDHREETEELMRKYEARLYILQQARRDPLTKQISDNQILLQELGPGDGVIMAFDNVLQ
KLLEDYGSDDTRNVKETTEYLKTSWINLKQSVADRQNALEAEWKMVQASRRDLENFLKWI
QEAETTVNVLADASHRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKA
LGNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKD
EELKKQMPIGGDVPALQLQYDHCKALRRELKEKEYSILNAVDQARVFLADQPIEAPEEPR
RNLQSKTELTPEERAQKIAKAMRKQSSEVKEKWENLNAVTSNWQKQVDKALEKLRDLQGA
MDDLDADMKEAESVRNGWKPVGDLLIDSLQDHIEKIMAFREEIAPINLKVKTVNDLSSQL
SPLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQ
RSISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLD
LLELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWL
LNVYDTGRTGKIRVQSLKIGLTSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAI
QIPRQLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVA
AAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIP
TTSGEDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEHYDP
SQSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGE
SPVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLRRGLPVGSPP
ESIVSPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESD
SRINGVSPWASPRHSTLSSSLDPDTSGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTF
PSCCPNVPSRPQAM
Download sequence
Identical sequences F7DLF6
ENSCJAP00000035892 ENSCJAP00000035998 XP_002747149.1.60252 XP_008993448.1.60252 XP_008993449.1.60252 XP_017826945.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]