SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036201 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036201
Domain Number 1 Region: 23-144,176-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-76
Family Calponin-homology domain, CH-domain 0.0000335
Further Details:      
 
Domain Number 2 Region: 5977-6136
Classification Level Classification E-value
Superfamily Spectrin repeat 8.06e-22
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 3 Region: 5888-6023
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-16
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 4 Region: 4916-5057
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000705
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 5 Region: 6548-6662
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000187
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 6 Region: 6242-6350
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000302
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 7 Region: 5069-5173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000518
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 5139-5271
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000131
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 9 Region: 5766-5919
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000243
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 10 Region: 6624-6766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 11 Region: 5249-5383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 5597-5710
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000406
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 13 Region: 3737-3884
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000108
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 2104-2220
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 15 Region: 2702-2834
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 16 Region: 1894-2036
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000417
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 17 Region: 2229-2356
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000619
Family Spectrin repeat 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036201
Domain Number - Region: 3217-3321
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000113
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 1441-1544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000273
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 4834-4945
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000587
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number - Region: 1531-1653
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00072
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 2804-2942
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00259
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number - Region: 1120-1227
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00273
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 356-434,616-666
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0114
Family Spectrin repeat 0.0086
Further Details:      
 
Domain Number - Region: 2500-2622
Classification Level Classification E-value
Superfamily Spectrin repeat 0.015
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number - Region: 1785-1904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0232
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1617-1726
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 3313-3469
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036201   Gene: ENSCJAG00000019341   Transcript: ENSCJAT00000038232
Sequence length 6871
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:88749574:89131645:1 gene:ENSCJAG00000019341 transcript:ENSCJAT00000038232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSPQLPTEDEQVSWGIDDLQISLQAEQEDTQKKTFTCWINSQLARHTSPSVISDLFTD
IKKGHVLLDLLEVLSGQQLPRDKGSNTFQCRINIEHALTFLRNRSIKLINIHVTDIIDGN
PSIILGLIWTIILHFHIEKLAQTLSCNYNQPSLDDVSVVDSSPTSSPPAKKCSKVQARWQ
MSAKKALLFWAQQQCATYESVNVTDFKSSWRNGMAFLAIIHALRPDLIDMKSVKHRSNKD
NLREAFRIAERELKIPRLLEPEDVDVVDPDEKSIMTYVAQFLQYSKDARGTGEEARGKVK
NAVVWLTLQKEELQKLLKDSENDTYFQKYNSLLSFMESFNEEKKSFLDVLTIKRNLDELD
KDQLQLGEAWDGLNHQINAWTVELNCALPPPLHQTEAWLQEVEGLMDEDLSTSQDYSQDM
TLIQEKMTLFKSLMDRFEYHSTNLLTFENRDENHLPLVPPDKLEEMKRRINNILEKKFIL
LLEFHYYKCLVLGLLDEVKSKLDIWNIKYGSRESVELLLEDWHKFIEEKGFLAQLDTSFQ
KCEEIYKNLAGECQNISKQYMVMKSDVCTYRKNIDNVKSTLQKVLAYWATYVENLCLLRA
CFEETKKEEIKEVPFETLAQWNLEHDTLNEAGNFLIEVSNDVVGSSISKELRRLNKRWRK
FVSKTQLEMNLPLIKKQDQPTFDNSGNIQLSEEEKATVEFSTDLSIELPENYNQNIKAGE
EHEKENEESTGQLKVAKDVEKVIGQVEIWEAETKSVLDLLRDEDDVNTSVEESLKHLIAK
GSMYEELMARTEDMLHMDIQNFSSQESFQHVLTTGLQAKIQAAKEKVQINVVKLVAALKN
STDISPELDVRLKMEESQKELESYMTRAQQLLGQRESPGGLISKYKEALIISNTKSLAKY
LKAVEELKKNVTEDIKMSLEEKSRDICATWESLHHELSLYVQQLKIDIEKGKLSDSILKL
EKQINKEKKLIRRGRTKGLIKEHEACFSEEACLYQLNHHMEVLRELCEELPSQKSQQEVK
RLLKDYEQKIERLLKCASEIYTTLQATAGGTSRNEGTITTSENRGGDSHSEVLFAKSDNQ
PSAEKAMKPVMNFSLASELKPRQEESMMEKDYSASINSLLERYDTYRDNLEHHLQNSEFR
VTSDFSSEEDRSSSCLQAKLTDLQVLKNETDACWKEFEIISLKSENLANDIKKPFIVKER
DRLKERERELQMTLNTRMQSLETALQLVLPVEKTSLLLCGSDLPLRKMAIQEFGLINADG
IYQHLRNIQDSIGKQTEICNRLEEPGNFVLKELHPCDLRAMQNIILKYKTQFEEMNRRVQ
RSEDTLRALEGFLESLKTAKLSTEPVIDLSASETQVAQENTLTVKNTEGDIHLMKDKAKH
LDKRLKMLDMSFKDAEQGEDTSCENLVDALLVQLSETHGYGVQEEFTEENTLLEACIFKN
NELLKNIQDVQSQVSKIGLKDPTVPAVKHRKRSLIRLDKDLDEYEEEKKHLQEMANSLPH
CKDGREKAVSQRCQSTILLWENTKAFITECLEQCGRVLELLKQYQNFKGILTTLIQKEES
VISLQASYMGKENLKKRIAEIEIVKEEFNEHLEVVDKINQICKNLQFHLNKMKTFEEPPF
EKEANIIVDRWLDINEKTEDYYESLGRALALWDKLFNLKNVIDEWMEKALQKMELHQLTE
EDRERLKEELQVHEQKASEFSQRVAEIQFLLQSSEIPLELQVMESSILSKMEHVQKCLTG
ESSNYALSGSTAELREDLDQAKTQIGMTESLLKALSPSDSLEIFTKLEEIQQQILQQKHS
MILLENQIGCLTPELSELKKQYESISDLFNTKKSLLQDHFSKLLNDQCKSFNDWFGNIKM
NLKECFESPETKGSVEQKLQKLSDFLTLEGRNSKIQQVDSVLKHVKKHLPKAHVKELSSW
LVGQEFELEKMESICQARAKELEDYLEHLLRLQDDHRNLSKWLSNQEEKWKGMEESGEKT
ELFCHALARKREQFESVAQLNNSLKEYGFTEEEEIIMEATCLMDRYQTLLRQLSEIEEED
KLPPMEDQSFNDLAHDVIHWIKEIKESLMVLNSSEGKMPLEERIQKIKEIILLKPEGDAR
IETIMKQAESSEALMVQKTLTDISNQWDNTLHLASTYLSHQEKLLLEGEKYLQSKEDLRL
MLTELKKKQEAGFALQHGLQEKKAQLKIYKKFLKKAQDLTSLLKELKSQGNYLLECTKNP
SFSEEPWLEIKHLHESLLQQLQDSVQNLEGHVREHDSYQVCVTDLNTTLDNFSKEFISFS
DKPVDQIAVEEKLQKLQELENRLSLQDGTLKKILALAKSVKQNTSSAGQKIIKDDIKSLK
YKQKDLENRLESAKQEMEYCLNSILKSKCSSKKKEKFPLPGREKQATSDVRESTQESAAM
EKLEEDWEINKDSAVETVMSKQLSLSVQESMKNTEDEQKVNELQNQPLELDIMLRNEQLE
EIKELYTQLEAKKAALEPLEQTECLNKTETGALGLHSVGYLAQHLDTLLQALITLKKNKE
SQYCLLRDFQEHLAAVESSMKASLTDKESLKVGPLDSVTYLDKIKKFIASVEKEKDSLGN
LKLKWENLSNHVTDMDKKLLESQIKQLEHGWEQVEQQIQRKYSQQVVEYGEFTSLMNKIR
DTEIFLQQQQQHLQLRLKSPEEQAGNQSVIALTTDLQAAKHGFSILKGQAEFQMKRIWGE
KEKKILDDGINNLKKQWETLEPLNLEAENQIKKCDIRNKMKETILWAKNLLGELIPSISL
LPDDILSQIRKCKVTHDGILDRQQSVESLAEEVKDKVPSLTACEGSDLNSTLEDLRDQYQ
MLVLKSTQRSQQLEFKLEERSNFFAIIRKFQLMAQESETLITPKVETTATEAELKHHHVT
LKASQKELQEIDKVISTYLQELTNIYEELNVFERLFLDDQLKNLKNRTNRTQRFIQNKCN
EVEHKINFCREFHEKSLALQEEVDSIQHNELLLNQEVNTGVKEDIYNLKDRLTAIKCSIL
QVLKLKKVFDFIGVNWDFSQLDQLQTQAFEKERELAEKIKQLDTFEEEHGKYQALLSEMR
AIDLQIKKMTEVVLKAPDSSPESRLLNAQMLSQRIEKAKCLCEEIIKKLNDSKAFDDSFK
EKEMLQIKLNAEENDKLYRVLQNMVLDLPPKEMDEKNFQDKLETSFHVLNQIKSQLQQPL
LISLEIKHIQNEKDNCKVFQEQVWAEVCSIRAVAVTEKQREENSSEASDVETKLRDFEDL
QMQLTTSVDLRINVLNNAYENLTRYKEAVTRAVESITSLEAVVVHYRMDTGNPEESLAVP
LRKQEELESTIADIQDLTEKLGMISSPETKLQLQCTLQELVSKNSAMKEAVRVQETEAER
YLENYKCCRKIEEDIYTNLSKIETVLGQSMSSLPLSYREALEHLEQSKALVSNLVSTKEE
LMKLRQILRLLRLRCTENDGICLLKIVSALWVKWLSLLEAAKEWEMWCEELKQEWKFVSE
EIEREAIILDNVQEELPEISKTKEDATTEELSELLDCLCQYGENVEKQRLLLTLLLQRIR
SIQNVPEGSGAVETVPAFQEITSMQERCNQLLQKAQKNKGLVQTEIQERHSFTKEIIALK
NLFQQTTTSFQNMALQDHTEKAEQLEELQSILKKGKLTFENIMEKLRIKYSEMYTIVPAE
IESQVEECRKALEDIDEKISNEVLKSSPTYAMKRKIEEINNGLHNVEKMLQQKSKNIEKA
QEIQKKMWDELDLWHSKLNELDSEVQDIVEQDPGQAQEWMDNLMIPFQQYQQVSQRAESR
TSQLNKATVKMEEYSDLLKSTEAWIENTSRLLANPADYDSSKTLSHHASTLQMALEDSEQ
KHNLLHSILMDLEDLSIIVKTDELTQSIQELSNQVTALQQKIMENLPQIQQMADDVVAIE
SEVKSMEKRVSKIKTILLSKEMLDFSPEEHLKHGEVILENICPMKKTIAEIVSYQVGLRL
PQTGMKPLPVFQRTNQLLHNIKLLENVTQEQNELLKVVIKQTNEYDEEIENLKRILNNHS
AQFSFEHMSPDQAAKLPQLQGEIEGMEKQILSLNQKKEDLLVDLKSTVLNLHQHLKQEQE
KVERDVLPAVASEEGRAAERDASEWKLNRRDSMSYLAAVEEEAEESSVKSKNGDEKAELP
PQSWSSFWKHDKDVEEDRASSSSGTIVQEAYGKISTCDNSMAQILAPDSPNTEQGSECSL
RTKQIEEGTTPPIKVATLDFSDTQGGLEHRVEKTRPEPAEVLHACKTQVAELELWLQQAN
VAFEPETLNADMQQVVEQQLVGCQAMLTEIEHKVAFLLEACKDQGLGDNGATQYEAEALS
LKLKTVKCNLEKVQMMLQEKHSEDQHPTILKKRSEPEYQKVRQPVNLPELESTVTERPQF
SRQKDFQQQQVLELKPMEQKDFIKFIEFNAKKMWPQYCQHDKATTQESSARSNQASSPEN
DVPDLMLSPQGQNGDKWQYLHHELSSKMKLPLPQLVEPQVSTKMSILPSVSMYNFRYPTT
EELQTYTTQLEDLRQEASDLQTQENMTEEMYVNLDKKLFELFLTLRQCLSSVEEVLQMAE
LYREDGSAQQAHYETLALELKKLYLALSDKKEDLLKAMTWPGRNTNLLLECFDNLQVCLE
HAQAAAASRSKSLKAGLDYNRSFQNEIKRLYDQLIKSKTSLQQSLNEISGQSVAEQLQKA
DAHTVELENSESQVAKLRDEGERLHLPYALLQEVYKLEDVLDSMWGILRARYAELSGPFV
TESQQDALLQGVVQLVKIGKEKLAHDHLKQTKSKGALQAQIENHKVFFQKLVADMLLIQA
YSAKILPSLLQKRETFWAEQVTEVKILEEKSRQRGMKLQSLLQKWEEFDENYASLEKDLE
ILLSTLPSVSLVEETEERLVERISFYQQIKRNIGGKHARLYQTLNEGKQLVASVSCPELE
GQIAKLEEQWLSLNKKIDHELHRLQTLVKHLLSYNRDSDQLTKWLESSQHTLNYWKEQSL
NVSQDLDTIRSNINNFFEFSKEVDEKSSLKTAVISTGNQLLHLKETDTATLRASLAQFEQ
KWTMLITQLPDIQEKLHQLQMEKLPSRKAITEMISWMNNVEHQTSDEDSMHSPSSASQVK
HLLQKHKEFRMEMDYKQWIVDFVNQSLLQLSTCDVESKRYERTEFAEHLGEMNRQWHRVH
GMLNRKIQHLEQLLESITESENKIQVLNNWMEAQEERLKTLQKPESVISVQKLLLDCQDI
ENQLAIKSKALDELKQSYLTLESGGMPLLEDTASRIDGLFQKRSSVITQVNQLKISMQSV
LQEWKIYDQLYDEVNMMTIRFWYCMEHSKPVVLSLEALRCQVEKLQSLQDEAESSEGSWE
KLQEVIGKLKGLCPSVAEIIEEKCRDTHKRWTQVNQAIADQLQKAQSLLQLWKAYSNAHG
EAAARLKQHEAKFQQLANISMSGNNLAEILPPALQDIKELQHDVQKTKEAFLQNSTVLDR
LPQPAESSTHMLLPSPLHSLQRAAYLEKMLLVKANEFEFVLSQFKDFGDRLESLKGLLMH
EEENLDRLHQQEKENPDSFLNHLLALTAQSPDIEHLNEVSLKLPLSDIAVKTLQNMNRQW
IRATATALERCSELQGIGLNEKFLCCCEKWTQLLEKIEEALKVDVANSLPELLEQQKTYE
MLEAEVSINQTIADSYVTQSLQLLDTTEIENRPEFISEFSKLTDRWQNAVQGVRQRKSDI
DGLVRQWQDFTTSVEDLLRFLTDTSHLLSAVKGQEHFSLNQTRSLIHELKNKKIHFQRWR
TTYAVTLEAGEKLLLRTNLETKESVGRKISQLQDNWNNTEPPLAEMIHQFQSTVETWDQC
EKKIKELKSRLQVLKAQSEDPLPELHEDLHNEKELIKELEKSLASWTQNLKELQTMKADL
TRHVLVEDVMVLKEQIEHLHRQWEDLCFRVAIRKQEIEDRLNSWIVFNEKNKELCAWLVQ
MENKVLQTADISIEEMIEKLQKDCMEEINLFSENKLQLKQMGDQLMKASNTSRAAEIDDR
LNKVNDRWQHLFDVIGSRVKKLKETFAFIQQLDKNMSNLRTWLARIESELSKPVVYDVCN
DQEIQKRLAEQQDLQRDIEQHSAGVESVFNICDVLLHDSDACANETECDSIQQTTRSLDR
RWRNICAMSMERRMKMQYTLLTTLTVTISLRNAPDQVGQRRPNAWFQGEHDTPYTMAGLS
PKTLGQGIVEHILERYNKTCKRLMHKNRQKAWHGRSGASSKDRGKSLIWTMVSTNVISSP
LLQHFTNQREEFEGTRESILVWLTEMDLQLTNVEHFSESDADDKMRQLNGFQQEITLNTN
KIDQLIVFGEQLIQKSEPLDAVLIEDELEELHRYCQEVFGRVSRFHRRLTSRAPGLEDEK
EASENETDMEDPREIQTDSWHKSGESEEPSSPQSLCHLVPPAPGHERSGCETPVSVDSIP
LEWDHTGDVGGSSSHEEDEEGPYYSALSGKSISDGHSWHVPDSPSCPKHHYKQTEGVGNV
PPVPAESSTPYNPPYGKLLLPPGTDGGKEDPRVLNGSPQPGDGRLAGITAQQSGAFDRWE
LIQAQELHNKLKIKQNLQQLNSDISTITTWLKKTKAELEMLKMAKPPSDIQEIELRVKRL
KEILKAFDTYKALVVSVNMSSKEFLQTESAESTELQSRLRQLSLLWEATQGMVDSCRGSL
RQSLMQCQDFHHLSQNLLLWLASAENRRQKAHVAHPKADPQALLECQRELVQLEKELVEC
QPQVDLLQEISNSLLIKGHGEEYIEAEEKVHVIDKKLKQLREQVSQDLISLQGTQNPDSP
LPGFDKVDTGDQPLSASMPAPRTKQFRGERTTEGEEETESRVAGSTRPQRSFLSRVIRAP
SSEEDYSCTQANNFARSFYPMLRYTNGPPPT
Download sequence
Identical sequences F7GEV8
ENSCJAP00000036201 ENSCJAP00000036166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]