SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036396 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036396
Domain Number 1 Region: 597-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-64
Family SPRY domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily DEATH domain 2.12e-24
Family Pyrin domain, PYD 0.0026
Further Details:      
 
Domain Number 3 Region: 369-434
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036396   Gene: ENSCJAG00000019582   Transcript: ENSCJAT00000038440
Sequence length 784
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:3288233:3304595:-1 gene:ENSCJAG00000019582 transcript:ENSCJAT00000038440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKKHSRIPRGQIQTARPVKMASLLVTY
YGEEYAVRLTLQVLRAMNQRLLAEELHRAAVQEYSAEESGTDCSAASLKPEPRSLKTLDD
LPEGKERSCPRQCGDGAANPRCPQPEAGGGCLGRGLPRKAPGKHREIASEGLDTQGKPRT
RTQSPALTSGRSPSRAREGVQAQVQLRRNASSAGRLQGLAGGTLGRRECRAFEVNQPSGK
KRPKSLEFTVSTGEKAPPNPEILLTLEEMRAVNPDLAAASQAGSTPDGGASADPGEGSGN
PERLVTGRPPDKAASPHCHTQEGGPVGGTCLHDSCSCPQAASGHPEATGSCTPGCPRCQA
SHERKSTGSLSPQPLPQCKRHLKQVQLLFCKDHGEPICLICSMSQEHRGHQMCPIEEAAL
EHKEQIQEQLKYLKKLRTSGEEERSYGNEKAASFLKQTEMLKQRVQRKLEQLYHFLEQQE
HVFVASLEDLGQMVGQFKKAYDTRVSRDIALLDTLIGELEAKQCQSEWELLQDFGDILHR
AKKVPVPQRWTPPEEIKEKIHLLHQKSEFVEKSAKYFSETLRLEMEMFNVPELTGAQAHA
VNMILDAETANPNLVFSDDLKSVRLGNQWERLPDGPERFDSCILALGSPSFISGRHYWEV
EVGDKTGWVLGACEASISKKGNITLSPDKGYWVVIMMKANEYQASSVPPTRLVIKEPPKR
VGILVDCRGGSISFYNVTAGSHIYTFSSCSFSGPLQPLFSPGTHDGGKNTGPLTICPVGG
QGPE
Download sequence
Identical sequences F7GDV0
ENSCJAP00000036396 ENSCJAP00000031741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]