SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036411 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036411
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-38
Family SCAN domain 0.0000409
Further Details:      
 
Domain Number 2 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 5 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 513-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000335
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 210-265
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000144
Family KRAB domain (Kruppel-associated box) 0.0049
Further Details:      
 
Domain Number 8 Region: 375-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000825
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036411   Gene: ENSCJAG00000019612   Transcript: ENSCJAT00000038460
Sequence length 684
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:3322888:3331074:1 gene:ENSCJAG00000019612 transcript:ENSCJAT00000038460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLVPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALS
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNHGRGTEVLLEETLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQ
RDPQAVKERALSAPWLSLFPPEGNMEDKMTGPQLPESLEDVAVYISQEEWGHQDPSKRAL
SRDTVQESYENVDSLESHIPSQEVPSTQVGQGGKLWDPSVQSCKESLSPRGPVPGEEKFE
NLEEGVPSVSPENTHPQVLLPDQVRGEVPWSPELGRPRDRLQGDWAPPPEGGMEPSSAGA
SNGRELGRPKELQPKKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCLGMDCSEIFGGNP
RFLSLHRAHLGDEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKRFSCNSNLHR
HQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCHECGKSFSRSSHLVIHERT
HERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDRFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences F7EWU1
XP_002755879.1.60252 ENSCJAP00000049682 ENSCJAP00000036411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]