SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036419 from Callithrix jacchus 76_3.2.1

(show help)
Strong hits

Sequence:	ENSCJAP00000036419
Domain Number 1	Region: 198-254
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.16e-22
Family	Classic zinc finger, C2H2	0.008
Further Details:

Domain Number 2	Region: 159-211
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	5.12e-20
Family	Classic zinc finger, C2H2	0.0073
Further Details:

Domain Number 3	Region: 239-291
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.03e-19
Family	Classic zinc finger, C2H2	0.0037
Further Details:

Domain Number 4	Region: 1-51
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	1.44e-16
Family	KRAB domain (Kruppel-associated box)	0.0021
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSCJAP00000036419 Gene: ENSCJAG00000036662 Transcript: ENSCJAT00000038469
Sequence length	296
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:12:3345987:3360239:1 gene:ENSCJAG00000036662 transcript:ENSCJAT00000038469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MYFSQEEWELLDPTQKALYNDVMQENYETVISLALFVLPKPKVISCLEQGEEPWVQVSPE FKDSARGSSTGLKLKNDTENHQPIFLSDLEIQAPADIISKKAKGKVPQKIAGKENHVDMH RVGKWHQDFPVKKRKKLSTWKQELLKLMDLHKKDRAREKPFKCQECGKTFRVSSDLIKHQ RIHTEEKPYKCQQCDKRFRWSSDLNKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHT GEKPFTCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Download sequence
Identical sequences	F7EWH4 ENSCJAP00000036419 ENSCJAP00000036419

SEARCH