SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036577 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036577
Domain Number 1 Region: 728-943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-104
Family Thrombospondin C-terminal domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 601-726
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.31e-34
Family TSP type-3 repeat 0.00000525
Further Details:      
 
Domain Number 3 Region: 217-262
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 3.14e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 532-603
Classification Level Classification E-value
Superfamily TSP type-3 repeat 8.63e-16
Family TSP type-3 repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 25-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000334
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 6 Region: 457-544
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000288
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 7 Region: 372-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000541
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 290-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000879
Family EGF-type module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036577
Domain Number - Region: 429-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00449
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036577   Gene: ENSCJAG00000019641   Transcript: ENSCJAT00000038635
Sequence length 961
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:128138105:128185430:-1 gene:ENSCJAG00000019641 transcript:ENSCJAT00000038635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAPLGAAVLLLHLVLQPWLAAGAQATPQVFDLLPSASQRLNPSALLPVLTDPTLNDLYV
ISTFKLQTKSSATIFSLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGAIELYLDCTQVDSIHNLPRAFAGLSQSPGAIELRTFQRRPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMAQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLRFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSREGFQCGPCPEGYTGNGITCIDIDECKYYPCYLGVRCVNLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGVCVPNSICINTLGSYRCGPCKPGYTGDQTRGCKT
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCVSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRFPNRDQRDEDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTIINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKVLV
SKTGPGEHVRNSLRHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N
Download sequence
Identical sequences F7F967
ENSCJAP00000036577 ENSCJAP00000036565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]