SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036580 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036580
Domain Number 1 Region: 637-852
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-104
Family Thrombospondin C-terminal domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 510-635
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.22e-34
Family TSP type-3 repeat 0.00000525
Further Details:      
 
Domain Number 3 Region: 126-171
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.75e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00096
Further Details:      
 
Domain Number 4 Region: 441-512
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.59e-16
Family TSP type-3 repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 366-453
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000288
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 6 Region: 281-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000485
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 199-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.03
Further Details:      
 
Domain Number 8 Region: 8-64
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000712
Family Laminin G-like module 0.03
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036580
Domain Number - Region: 331-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0116
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036580   Gene: ENSCJAG00000019641   Transcript: ENSCJAT00000038638
Sequence length 870
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:128138191:128184216:-1 gene:ENSCJAG00000019641 transcript:ENSCJAT00000038638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLNKAILRYLKNDGKIHLVVFNNLQLADGRRHRILLRLSNLQRGAGAIELYLDCTQVD
SIHNLPRAFAGLSQSPGAIELRTFQRRPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPL
AATGTGDFNRQFLGQMAQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLRFQSPTP
STVVPPAPPAPPTRPPRRCDSNPCFRGVQCTDSREGFQCGPCPEGYTGNGITCIDIDECK
YYPCYLGVRCVNLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQVCTDIDECRNGVCVPN
SICINTLGSYRCGPCKPGYTGDQTRGCKTERNCRNPELNPCSVNAQCIEERQGDVTCVCG
VGWAGDGYVCGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDA
DGDGILNEQDNCVLIHNVDQRNSDKDIFGDACDNCVSVLNNDQKDTDGDGRGDACDDDMD
GDGIKNILDNCPRFPNRDQRDEDGDGVGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDS
DGDGHQDSTDNCPTIINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGPDNCRLVPNPAQ
EDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWV
VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVV
MWKQTEQTYWQATPFRAVAEPGIQLKVLVSKTGPGEHVRNSLRHTGDTSDQVRLLWKDSR
NVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGRLGVFCFSQENI
IWSNLKYRCNDTIPEDFQEFQTQNFDRLDN
Download sequence
Identical sequences F7F8X0
ENSCJAP00000036580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]