SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036737 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036737
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily POZ domain 7.06e-26
Family BTB/POZ domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036737   Gene: ENSCJAG00000019754   Transcript: ENSCJAT00000038797
Sequence length 410
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:131304120:131306515:1 gene:ENSCJAG00000019754 transcript:ENSCJAT00000038797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNNELMADVHFVVGLPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPA
AFLTLLKYMYSDEIDLEADTVLATLYAAKKYIVPALAKACVNFLETSLEAKNACVLLSQS
RLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIIITREALNTKEAVVFEAVLNW
AEAECKRQGLPVTPRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWY
TATNKPRLDFPLTKRKGLAPQRCHRFQSSAYRSNQWRYRGRCDSIQFAVDRRVFIAGLGL
YGSSSGKAEYSVKIELKRLGVVLAQNLTKFMSDGSSNTFPVWFEHPVQVEQDTFYTASAV
LDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIFYA
Download sequence
Identical sequences F6R5Q1
ENSCJAP00000036737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]