SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037275 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037275
Domain Number 1 Region: 146-367,411-460
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.22e-50
Family LacY-like proton/sugar symporter 0.055
Further Details:      
 
Domain Number 2 Region: 576-717
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.53e-19
Family Glycerol-3-phosphate transporter 0.032
Further Details:      
 
Domain Number 3 Region: 484-565
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000196
Family Pentapeptide repeats 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037275   Gene: ENSCJAG00000020031   Transcript: ENSCJAT00000039374
Sequence length 727
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:132018042:132272654:-1 gene:ENSCJAG00000020031 transcript:ENSCJAT00000039374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYP
AGETYDGEANDDEGSSEATEGHDEYDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDR
RELESERRADEEELAQQYELIIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAE
TDLCIPNSGSGWLGSIVYLGMMVGAFFWGGLADKVGRKQSLLICMSVNGFFAFLSSFVQG
YGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLSWLCMFWMIGGIYASAMAWAI
IPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEVGKHDEAWMIL
KLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT
FMRCFNYPVRDNTTKLTIVWFTLSFGYYGLSVWFPDVIKHLQSDEYALLTRNVQKDKYAN
FSINFTMENQIHTGMEYDNGRFVGVKFKSVTFKDSVFKSCTFEDVTSLNTYFRNCTFIDT
VFDNTDFEPYKFIDSEFKNCSFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVS
ALLMDRIGRLTMLGGSMVLSGISCFFLWFGTSESMMIGMLCLYNGLTISAWNSLDVVTVE
LYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVGITKAIPILLASTVLVCGGLVGLRLPD
TRTQVLM
Download sequence
Identical sequences F6UWY8
ENSCJAP00000037275 XP_002744895.1.60252 XP_008990166.1.60252 ENSCJAP00000037275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]